PDB entry 3mm2

View 3mm2 on RCSB PDB site
Description: Dye-decolorizing peroxidase (DyP) in complex with cyanide
Class: oxidoreductase
Keywords: DyP, Dye-decolorizing peroxidase, beta barrel, aspartic acid, OXIDOREDUCTASE
Deposited on 2010-04-19, released 2011-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DyP
    Species: Bjerkandera adusta [TaxId:5331]
    Gene: dyp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3mm2a_
  • Heterogens: HEM, NAG, CYN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mm2A (A:)
    andtilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdps
    qqplafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgv
    fligsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtg
    wettvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaip
    ansagnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltde
    trcpfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyq
    siigngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfv
    ipkggeyfflpsisaltatiaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm2A (A:)
    tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
    lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
    gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwet
    tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
    agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
    pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
    gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
    ggeyfflpsisaltatiaa