PDB entry 3mm0

View 3mm0 on RCSB PDB site
Description: Crystal structure of chimeric avidin
Class: biotin binding protein
Keywords: avidin, AVR4, high affinity systems, hyper-thermostability, BIOTIN BINDING PROTEIN
Deposited on 2010-04-19, released 2010-10-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0a_
  • Chain 'B':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0b_
  • Chain 'C':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0c_
  • Chain 'D':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0d_
  • Chain 'E':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0e_
  • Chain 'F':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0f_
  • Chain 'G':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0g_
  • Chain 'H':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0h_
  • Chain 'I':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0i_
  • Chain 'K':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0k_
  • Chain 'M':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0m_
  • Chain 'N':
    Compound: Avidin, Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4, AVR5, AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701 (Start-39)
    • Uniprot P56734 (40-60)
    • Uniprot P02701 (61-End)
      • engineered (117)
    Domains in SCOPe 2.01: d3mm0n_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mm0A (A:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0A (A:)
    csltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptfg
    ftvnwkfsesttvftgqcfigkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mm0B (B:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0B (B:)
    csltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptfg
    ftvnwkfsesttvftgqcfigkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mm0C (C:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0C (C:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
    gftvnwkfsesttvftgqcfirngkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mm0D (D:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0D (D:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
    gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mm0E (E:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0E (E:)
    csltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptfg
    ftvnwkfsesttvftgqcfingkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mm0F (F:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0F (F:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
    gftvnwkfsesttvftgqcfidrgkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mm0G (G:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0G (G:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgitlspllgiqhkrasqptfg
    ftvnwkfsesttvftgqcfidrgkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mm0H (H:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0H (H:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
    gftvnwkfsesttvftgqcfigkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3mm0I (I:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0I (I:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
    gftvnwkfsesttvftgqcfidrgkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3mm0K (K:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0K (K:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
    gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3mm0M (M:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0M (M:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkrasqptf
    gftvnwkfsesttvftgqcfigkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3mm0N (N:)
    qtvarkcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkra
    sqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyni
    ftrlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mm0N (N:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavadnpgnitlspllgiqhkasqptfg
    ftvnwkfsesttvftgqcfirngkevlktmwllrssvndigddwkatrvgyniftrl