PDB entry 3mlz

View 3mlz on RCSB PDB site
Description: Crystal structure of anti-HIV-1 V3 Fab 3074 in complex with a VI191 V3 peptide
Class: immune system
Keywords: human monoclonal antibody, Fab, HIV-1, gp120, third variable loop, antibody-antigen interaction, IMMUNE SYSTEM
Deposited on 2010-04-18, released 2010-07-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.198
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLZ (0-229)
  • Chain 'L':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLZ (0-213)
    Domains in SCOPe 2.05: d3mlzl1, d3mlzl2
  • Chain 'P':
    Compound: HIV-1 gp120 third variable region (V3) crown
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mlzL (L:)
qsvltqppsvsaapgqkvtiscsgsssnignnmvswyqqhpgtapklliyenskrpsgip
drfsgsrsgtsatlgiiglqtgdeaeyycatwdgslrtvfgggtkltvlsqpkaapsvtl
fppsseelqankatlvclisdfypgavtvawkadsspvragvetttpskqsnnkyaassy
lsltpeqwkshrsyscqvthegstvektvaptec

  • Chain 'P':
    No sequence available.