PDB entry 3mlx
View 3mlx on RCSB PDB site
Description: Crystal structure of anti-HIV-1 V3 Fab 3074 in complex with an MN V3 peptide
Class: immune system
Keywords: human monoclonal antibody, Fab, HIV-1, gp120, third variable loop, antibody-antigen interaction, IMMUNE SYSTEM
Deposited on
2010-04-18, released
2010-07-14
The last revision prior to the SCOPe 2.06 freeze date was dated
2010-08-18, with a file datestamp of
2010-08-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3mlxl1, d3mlxl2 - Chain 'M':
Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3mlxm1, d3mlxm2 - Chain 'P':
Compound: HIV-1 gp120 third variable region (V3) crown
Species: HIV-1 M:B_MN [TaxId:11696]
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: HIV-1 gp120 third variable region (V3) crown
Species: HIV-1 M:B_MN [TaxId:11696]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>3mlxL (L:)
svltqppsvsaapgqkvtiscsgsssnignnmvswyqqhpgtapklliyenskrpsgipd
rfsgsrsgtsatlgiiglqtgdeaeyycatwdgslrtvfgggtkltvlsqpkaapsvtlf
ppsseelqankatlvclisdfypgavtvawkadsspvragvetttpskqsnnkyaassyl
sltpeqwkshrsyscqvthegstvektvapt
- Chain 'M':
Sequence; same for both SEQRES and ATOM records: (download)
>3mlxM (M:)
svltqppsvsaapgqkvtiscsgsssnignnmvswyqqhpgtapklliyenskrpsgipd
rfsgsrsgtsatlgiiglqtgdeaeyycatwdgslrtvfgggtkltvlsqpkaapsvtlf
ppsseelqankatlvclisdfypgavtvawkadsspvragvetttpskqsnnkyaassyl
sltpeqwkshrsyscqvthegstvektvapt
- Chain 'P':
No sequence available.
- Chain 'Q':
No sequence available.