PDB entry 3mlw

View 3mlw on RCSB PDB site
Description: Crystal structure of anti-HIV-1 V3 Fab 1006-15D in complex with an MN V3 peptide
Class: immune system
Keywords: human monoclonal antibody, Fab, HIV-1, gp120, third variable loop, antibody-antigen interaction, IMMUNE SYSTEM
Deposited on 2010-04-18, released 2010-07-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 1006-15D Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLW (0-227)
  • Chain 'I':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 1006-15D Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLW (0-227)
  • Chain 'L':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 1006-15D Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLW (0-214)
    Domains in SCOPe 2.03: d3mlwl1, d3mlwl2
  • Chain 'M':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 1006-15D Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLW (0-214)
    Domains in SCOPe 2.03: d3mlwm1, d3mlwm2
  • Chain 'P':
    Compound: HIV-1 gp120 third variable region (V3) crown
    Species: HIV-1 M:B_MN [TaxId:11696]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: HIV-1 gp120 third variable region (V3) crown
    Species: HIV-1 M:B_MN [TaxId:11696]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mlwL (L:)
qsvltqppsasgtpgqrvtiscsgnssniennyvywyqqlpgstpkllifrddqrpsgvp
drfsgsksgtsaslaisglrsedeadyycaswddsrggpdyvfgtgtkvtvlgqpkanpt
vtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaa
ssylsltpeqwkshrsyscqvthegstvektvapt

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mlwM (M:)
qsvltqppsasgtpgqrvtiscsgnssniennyvywyqqlpgstpkllifrddqrpsgvp
drfsgsksgtsaslaisglrsedeadyycaswddsrggpdyvfgtgtkvtvlgqpkanpt
vtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaa
ssylsltpeqwkshrsyscqvthegstvektvapt

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.