PDB entry 3mlv

View 3mlv on RCSB PDB site
Description: Crystal structure of anti-HIV-1 V3 Fab 2557 in complex with an NOF V3 peptide
Class: immune system
Keywords: human monoclonal antibody, Fab, HIV-1, gp120, third variable loop, antibody-antigen interaction, IMMUNE SYSTEM
Deposited on 2010-04-18, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLV (0-225)
  • Chain 'L':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLV (Start-218)
    Domains in SCOPe 2.07: d3mlvl1, d3mlvl2
  • Chain 'M':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLV (0-218)
    Domains in SCOPe 2.07: d3mlvm1, d3mlvm2
  • Chain 'N':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLV (0-225)
  • Chain 'P':
    Compound: HIV-1 gp120 third variable region (V3) crown
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: HIV-1 gp120 third variable region (V3) crown
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mlvL (L:)
    sylltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgegtrltvlaqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mlvL (L:)
    ylltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiperl
    sgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgegtrltvlaqpka
    apsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnk
    yaassylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mlvM (M:)
    sylltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgegtrltvlaqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'N':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.