PDB entry 3mlt

View 3mlt on RCSB PDB site
Description: Crystal structure of anti-HIV-1 V3 Fab 2557 in complex with a UG1033 V3 peptide
Class: immune system
Keywords: human monoclonal antibody, Fab, HIV-1, gp120, third variable loop, antibody-antigen interaction, IMMUNE SYSTEM
Deposited on 2010-04-18, released 2010-07-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLT (0-218)
    Domains in SCOPe 2.06: d3mlta1, d3mlta2
  • Chain 'B':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLT (0-225)
  • Chain 'C':
    Compound: HIV-1 gp120 third variable region (V3) crown
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLT (0-218)
    Domains in SCOPe 2.06: d3mltd1, d3mltd2
  • Chain 'E':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLT (0-225)
  • Chain 'G':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLT (0-218)
    Domains in SCOPe 2.06: d3mltg1, d3mltg2
  • Chain 'H':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLT (0-225)
  • Chain 'I':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLT (0-225)
  • Chain 'L':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLT (0-218)
    Domains in SCOPe 2.06: d3mltl1, d3mltl2
  • Chain 'P':
    Compound: HIV-1 gp120 third variable region (V3) crown
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mltA (A:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlgqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mltA (A:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastggtkltvlfgdgtrltvlgqpkaaps
    vtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaa
    ssylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mltD (D:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlgqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mltD (D:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdasgtkltvlfgdgtrltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mltG (G:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlgqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mltG (G:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdasgtkltvlfgdgtrltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mltL (L:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlgqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mltL (L:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgggtkltvlfgdgtrltvlgqpkaap
    svtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkya
    assylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'P':
    No sequence available.