PDB entry 3mls

View 3mls on RCSB PDB site
Description: Crystal structure of anti-HIV-1 V3 mAb 2557 Fab in complex with a HIV-1 gp120 V3 mimotope
Class: immune system
Keywords: human monoclonal antibody, Fab, HIV-1, gp120, third variable loop, antibody-antigen interaction, mimotope, IMMUNE SYSTEM
Deposited on 2010-04-18, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-225)
  • Chain 'I':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-225)
  • Chain 'J':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-225)
  • Chain 'K':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-End)
  • Chain 'L':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-218)
    Domains in SCOPe 2.07: d3mlsl1, d3mlsl2
  • Chain 'M':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-218)
    Domains in SCOPe 2.07: d3mlsm1, d3mlsm2
  • Chain 'N':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-218)
    Domains in SCOPe 2.07: d3mlsn1, d3mlsn2
  • Chain 'O':
    Compound: Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-218)
    Domains in SCOPe 2.07: d3mlso1, d3mlso2
  • Chain 'P':
    Compound: Rationally designed V3 mimotope
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-19)
  • Chain 'Q':
    Compound: Rationally designed V3 mimotope
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-19)
  • Chain 'R':
    Compound: Rationally designed V3 mimotope
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-19)
  • Chain 'S':
    Compound: Rationally designed V3 mimotope
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLS (0-19)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mlsL (L:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlgqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mlsM (M:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlgqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mlsN (N:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlgqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mlsO (O:)
    sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
    lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlgqpk
    aapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnn
    kyaassylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.