PDB entry 3mlp

View 3mlp on RCSB PDB site
Description: early b-cell factor 1 (ebf1) bound to dna
Deposited on 2010-04-17, released 2010-12-01
The last revision was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor COE1
    Species: Mus musculus [TaxId:10090]
    Gene: Ebf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07802
      • engineered mutation (228)
  • Chain 'B':
    Compound: Transcription factor COE1
    Species: Mus musculus [TaxId:10090]
    Gene: Ebf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07802
      • engineered mutation (228)
  • Chain 'C':
    Compound: DNA (5'-d(*cp*tp*tp*tp*ap*tp*tp*cp*cp*cp*ap*tp*gp*gp*gp*ap*ap*tp*ap*ap*ap*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(*cp*tp*tp*tp*ap*tp*tp*cp*cp*cp*ap*tp*gp*gp*gp*ap*ap*tp*ap*ap*ap*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'E':
    Compound: Transcription factor COE1
    Species: Mus musculus [TaxId:10090]
    Gene: Ebf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07802
      • engineered mutation (228)
  • Chain 'F':
    Compound: Transcription factor COE1
    Species: Mus musculus [TaxId:10090]
    Gene: Ebf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07802
      • engineered mutation (228)
  • Chain 'G':
    Compound: DNA (5'-d(*cp*tp*tp*tp*ap*tp*tp*cp*cp*cp*ap*tp*gp*gp*gp*ap*ap*tp*ap*ap*ap*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'H':
    Compound: DNA (5'-d(*cp*tp*tp*tp*ap*tp*tp*cp*cp*cp*ap*tp*gp*gp*gp*ap*ap*tp*ap*ap*ap*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: ZN, CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mlpA (A:)
    mnavrtwmqgagvldantaaqsgvglarahfekqppsnlrksnffhfvlalydrqgqpve
    iertafvgfvekekeansektnngihyrlqllysngirteqdfyvrlidsmtkqaivyeg
    qdknpemcrvlltheimcsrccdkkscgnrnetpsdpviidrfflkfflkcnqnclknag
    nprdmrrfqvvvsttvnvdghvlavsdnmfvhnnskhgrrarrldpseaatpcikaisps
    egwttggatviiigdnffdglqvifgtmlvwselitphairvqtpprhipgvvevtlsyk
    skqfckgtpgrfiytalneptidygfqrlqkviprhpgdperlpkevilkraadlvealy
    gmphnnqeiilkraadiaealysvprnhnqlaavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mlpA (A:)
    vldantaaqsgvglarahfekqppsnlrksnffhfvlalydrqgqpveiertafvgfvek
    ekeansektnngihyrlqllysngirteqdfyvrlidsmtkqaivyegqdknpemcrvll
    theimcsrccdkkscgnrnetpsdpviidrfflkfflkcnqnclknagnprdmrrfqvvv
    sttvnvdghvlavsdnmfvhnnskhgrrarrldpseaatpcikaispsegwttggatvii
    igdnffdglqvifgtmlvwselitphairvqtpprhipgvvevtlsykskqfckgtpgrf
    iyteptidygfqrlqkvpkevilkraadlvealygmp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mlpB (B:)
    mnavrtwmqgagvldantaaqsgvglarahfekqppsnlrksnffhfvlalydrqgqpve
    iertafvgfvekekeansektnngihyrlqllysngirteqdfyvrlidsmtkqaivyeg
    qdknpemcrvlltheimcsrccdkkscgnrnetpsdpviidrfflkfflkcnqnclknag
    nprdmrrfqvvvsttvnvdghvlavsdnmfvhnnskhgrrarrldpseaatpcikaisps
    egwttggatviiigdnffdglqvifgtmlvwselitphairvqtpprhipgvvevtlsyk
    skqfckgtpgrfiytalneptidygfqrlqkviprhpgdperlpkevilkraadlvealy
    gmphnnqeiilkraadiaealysvprnhnqlaavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mlpB (B:)
    vldantaaqsgvglarahfekqppsnlrksnffhfvlalydrqgqpveiertafvgfvek
    ekeansektnngihyrlqllysngirteqdfyvrlidsmtkqaivyegqdknpemcrvll
    theimcsrccdkkscgnrnetpsdpviidrfflkfflkcnqnclknagnprdmrrfqvvv
    sttvnvdghvlavsdnmfvhnnskhgraatpcikaispsegwttggatviiigdnffdgl
    qvifgtmlvwselitphairvqtpprhipgvvevtlsykskqfckgtpgrfiytalnept
    idygfqrlqkviprlpkevilkraadlvealy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mlpE (E:)
    mnavrtwmqgagvldantaaqsgvglarahfekqppsnlrksnffhfvlalydrqgqpve
    iertafvgfvekekeansektnngihyrlqllysngirteqdfyvrlidsmtkqaivyeg
    qdknpemcrvlltheimcsrccdkkscgnrnetpsdpviidrfflkfflkcnqnclknag
    nprdmrrfqvvvsttvnvdghvlavsdnmfvhnnskhgrrarrldpseaatpcikaisps
    egwttggatviiigdnffdglqvifgtmlvwselitphairvqtpprhipgvvevtlsyk
    skqfckgtpgrfiytalneptidygfqrlqkviprhpgdperlpkevilkraadlvealy
    gmphnnqeiilkraadiaealysvprnhnqlaavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mlpE (E:)
    vldantaaqsgvglarahfekqppsnlrksnffhfvlalydrqgqpveiertafvgfvek
    ekeansektnngihyrlqllysngirteqdfyvrlidsmtkqaivyegqdknpemcrvll
    theimcsrccdkkscgnrnetpsdpviidrfflkfflkcnqnclknagnprdmrrfqvvv
    sttvnvdghvlavsdnmfvhnnskhgrrarrldpseaatpcikaispsegwttggatvii
    igdnffdglqvifgtmlvwselitphairvqtpprhipgvvevtlsykskqfckgtpgrf
    iyt
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mlpF (F:)
    mnavrtwmqgagvldantaaqsgvglarahfekqppsnlrksnffhfvlalydrqgqpve
    iertafvgfvekekeansektnngihyrlqllysngirteqdfyvrlidsmtkqaivyeg
    qdknpemcrvlltheimcsrccdkkscgnrnetpsdpviidrfflkfflkcnqnclknag
    nprdmrrfqvvvsttvnvdghvlavsdnmfvhnnskhgrrarrldpseaatpcikaisps
    egwttggatviiigdnffdglqvifgtmlvwselitphairvqtpprhipgvvevtlsyk
    skqfckgtpgrfiytalneptidygfqrlqkviprhpgdperlpkevilkraadlvealy
    gmphnnqeiilkraadiaealysvprnhnqlaavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mlpF (F:)
    vldantaaqsgvglarahfekqppsnlrksnffhfvlalydrqgqpveiertafvgfvek
    ekeansektnngihyrlqllysngirteqdfyvrlidsmtkqaivyegqdknpemcrvll
    theimcsrccdkkscgnrnetpsdpviidrfflkfflkcnqnclknagnprdmrrfqvvv
    sttvnvdghvlavsdnmfvhnnskhgseaatpcikaispsegwttggatviiigdnffdg
    lqvifgtmlvwselitphairvqtpprhipgvvevtlsykskqfckgtpgrfiytaln
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.