PDB entry 3mlm

View 3mlm on RCSB PDB site
Description: Crystal structure of Bn IV in complex with myristic acid: A Lys49 myotoxic phospholipase A2 from Bothrops neuwiedi venom
Class: hydrolase
Keywords: Myotoxin, phospholipase-like protein, HYDROLASE
Deposited on 2010-04-17, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.207
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BN-IV Lys-49 Phospholipase A2
    Species: Bothrops neuwiedi pauloensis [TaxId:95649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IAT9 (0-120)
      • variant (1)
      • variant (34)
      • variant (53)
    Domains in SCOPe 2.07: d3mlma_
  • Chain 'B':
    Compound: BN-IV Lys-49 Phospholipase A2
    Species: Bothrops neuwiedi pauloensis [TaxId:95649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IAT9 (0-120)
      • variant (1)
      • variant (34)
      • variant (53)
    Domains in SCOPe 2.07: d3mlmb_
  • Heterogens: SO4, MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mlmA (A:)
    slfelgkmilqetgknpaksygaygcncgvlgrggpkdatdrccyvhkccykkitgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mlmB (B:)
    slfelgkmilqetgknpaksygaygcncgvlgrggpkdatdrccyvhkccykkitgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c