PDB entry 3mll

View 3mll on RCSB PDB site
Description: Reduced (Cu+) peptidylglycine alpha-hydroxylating monooxygenase (PHM) with bound azide
Deposited on 2010-04-16, released 2011-03-02
The last revision was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.244
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, NI, AZI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mllA (A:)
    fsneclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkpras
    mdtvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvgget
    gskyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvn
    adiscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvd
    vtfgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdm
    frtipaeanipipv
    

    Sequence, based on observed residues (ATOM records):
    >3mllA (A:)
    eclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdt
    vhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgsk
    yfvlqvhygdinhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadiscqyk
    mypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfgdila
    arcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfrtipaea
    nipi