PDB entry 3mlk

View 3mlk on RCSB PDB site
Description: Reduced (Cu+) peptidylglycine alpha-hydroxylating monooxygenase (PHM) with bound nitrite
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase, bioactive peptide activation, ascorbate
Deposited on 2010-04-16, released 2011-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mlka1, d3mlka2
  • Heterogens: CU, NI, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mlkA (A:)
    fsneclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkpras
    mdtvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvgget
    gskyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvn
    adiscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvd
    vtfgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdm
    frtipaeanipipv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mlkA (A:)
    eclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdt
    vhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgsk
    yfvlqvhygdirdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadiscq
    ykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfgdi
    laarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfrtipa
    eanipi