PDB entry 3mlh

View 3mlh on RCSB PDB site
Description: crystal structure of the 2009 h1n1 influenza virus hemagglutinin receptor-binding domain
Deposited on 2010-04-16, released 2010-12-01
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644887]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644887]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mlhA (A:)
    hhhhhhddddkgvaplhlgkcniagwilgnpeceslstasswsyivetsssdngtcypgd
    fidyeelreqlssvssferfeifpktsswpnhdsnkgvtaacphagaksfyknliwlvkk
    gnsypklsksyindkgkevlvlwgihhpstsadqqslyqnadayvfvgssryskkfkpei
    airpkvrdqegrmnyywtlvepgdkitfeatgnlvvpryafamernagsgiiisd
    

    Sequence, based on observed residues (ATOM records):
    >3mlhA (A:)
    aplhlgkcniagwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlss
    vssferfeifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyin
    dkgkevlvlwgihhpstsadqqslyqnadayvfvgssryskkfkpeiairpkvrdqegrm
    nyywtlvepgdkitfeatgnlvvpryafamer
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mlhB (B:)
    hhhhhhddddkgvaplhlgkcniagwilgnpeceslstasswsyivetsssdngtcypgd
    fidyeelreqlssvssferfeifpktsswpnhdsnkgvtaacphagaksfyknliwlvkk
    gnsypklsksyindkgkevlvlwgihhpstsadqqslyqnadayvfvgssryskkfkpei
    airpkvrdqegrmnyywtlvepgdkitfeatgnlvvpryafamernagsgiiisd
    

    Sequence, based on observed residues (ATOM records):
    >3mlhB (B:)
    vaplhlgkcniagwilgnpeceslstasswsyivetgtcypgdfidyeelreqlssvssf
    erfeifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgk
    evlvlwgihhpstsadqqslyqnadayvfvgssryskkfkpeiairpkvrdqegrmnyyw
    tlvepgdkitfeatgnlvvpryafamernagsg