PDB entry 3mlg

View 3mlg on RCSB PDB site
Description: 2ouf-2x, a designed knotted protein
Deposited on 2010-04-16, released 2010-05-12
The last revision was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2X chimera of Helicobacter pylori protein HP0242
    Species: Helicobacter pylori [TaxId:85962]
    Gene: HP_0242
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 2X chimera of Helicobacter pylori protein HP0242
    Species: Helicobacter pylori [TaxId:85962]
    Gene: HP_0242
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mlgA (A:)
    mrdyseleifegnpldkwndiifhaskklskkelerllellalletfiekedleekfesf
    akalrideelqqkiesrktdiviqsmanilsgsgsgsgssgnpldkwndiifhaskklsk
    kelerllellalletfiekedleekfesfakalrideelqqkiesrktdiviqsmanils
    glehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mlgA (A:)
    npldkwndiifhaskklskkelerllellalletfiekedleekfesfakalrideelqq
    kiesrktdiviqsmanilsggnpldkwndiifhaskklskkelerllellalletfieke
    dleekfesfakalrideelqqkiesrktdiviqsmanilsg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mlgB (B:)
    mrdyseleifegnpldkwndiifhaskklskkelerllellalletfiekedleekfesf
    akalrideelqqkiesrktdiviqsmanilsgsgsgsgssgnpldkwndiifhaskklsk
    kelerllellalletfiekedleekfesfakalrideelqqkiesrktdiviqsmanils
    glehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mlgB (B:)
    npldkwndiifhaskklskkelerllellalletfiekedleekfesfakalrideelqq
    kiesrktdiviqsmanilsggnpldkwndiifhaskklskkelerllellalletfieke
    dleekfesfakalrideelqqkiesrktdiviqsmanilsg