PDB entry 3mlf

View 3mlf on RCSB PDB site
Description: putative transcriptional regulator from staphylococcus aureus.
Deposited on 2010-04-16, released 2010-04-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Staphylococcus aureus subsp. aureus [TaxId:451516]
    Gene: USA300HOU_2003
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8Z4R3 (24-End)
      • expression tag (14-23)
  • Chain 'B':
    Compound: Transcriptional regulator
    Species: Staphylococcus aureus subsp. aureus [TaxId:451516]
    Gene: USA300HOU_2003
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8Z4R3 (24-End)
      • expression tag (16-23)
  • Chain 'C':
    Compound: Transcriptional regulator
    Species: Staphylococcus aureus subsp. aureus [TaxId:451516]
    Gene: USA300HOU_2003
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8Z4R3 (24-End)
      • expression tag (16-23)
  • Chain 'D':
    Compound: Transcriptional regulator
    Species: Staphylococcus aureus subsp. aureus [TaxId:451516]
    Gene: USA300HOU_2003
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8Z4R3 (24-End)
      • expression tag (16-23)
  • Chain 'E':
    Compound: Transcriptional regulator
    Species: Staphylococcus aureus subsp. aureus [TaxId:451516]
    Gene: USA300HOU_2003
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8Z4R3 (24-End)
      • expression tag (23)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mlfA (A:)
    mhhhhhhssgvdlgtenlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekds
    tnikdsllskymsafnvkyddiflgneyenfvftndkkksiilafkekqts
    

    Sequence, based on observed residues (ATOM records):
    >3mlfA (A:)
    tenlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekdstnikdsllskymsa
    fnvkyddiflgneyenfvftndkkksiilafkekq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mlfB (B:)
    mhhhhhhssgvdlgtenlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekds
    tnikdsllskymsafnvkyddiflgneyenfvftndkkksiilafkekqts
    

    Sequence, based on observed residues (ATOM records):
    >3mlfB (B:)
    nlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekdstnikdsllskymsafn
    vkyddiflgneyenfvftndkkksiilafkek
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mlfC (C:)
    mhhhhhhssgvdlgtenlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekds
    tnikdsllskymsafnvkyddiflgneyenfvftndkkksiilafkekqts
    

    Sequence, based on observed residues (ATOM records):
    >3mlfC (C:)
    nlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekdstnikdsllskymsafn
    vkyddiflgneyenfvftndkkksiilafkek
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mlfD (D:)
    mhhhhhhssgvdlgtenlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekds
    tnikdsllskymsafnvkyddiflgneyenfvftndkkksiilafkekqts
    

    Sequence, based on observed residues (ATOM records):
    >3mlfD (D:)
    nlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekdstnikdsllskymsafn
    vkyddiflgneyenfvftndkkksiilafkekq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mlfE (E:)
    mhhhhhhssgvdlgtenlyfqsnamktlkelrtdygltqkelgdlfkvssrtiqnmekds
    tnikdsllskymsafnvkyddiflgneyenfvftndkkksiilafkekqts
    

    Sequence, based on observed residues (ATOM records):
    >3mlfE (E:)
    amktlkelrtdygltqkelgdlfkvssrtiqnmekdstnikdsllskymsafnvkyddif
    lgneyenfvftndkkksiilafkekq