PDB entry 3mlc

View 3mlc on RCSB PDB site
Description: Crystal structure of FG41MSAD inactivated by 3-chloropropiolate
Class: isomerase
Keywords: Tautomerase superfamily, Malonate Semialdehyde Decarboxylase, Beta-alpha-beta-motif, Coryneform bacterium FG41, ISOMERASE
Deposited on 2010-04-16, released 2011-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLC (0-End)
    Domains in SCOPe 2.07: d3mlca_
  • Chain 'B':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLC (0-End)
    Domains in SCOPe 2.07: d3mlcb_
  • Chain 'C':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLC (0-End)
    Domains in SCOPe 2.07: d3mlcc_
  • Chain 'D':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLC (0-End)
    Domains in SCOPe 2.07: d3mlcd_
  • Chain 'E':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MLC (0-End)
    Domains in SCOPe 2.07: d3mlce_
  • Heterogens: PR6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mlcA (A:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mlcA (A:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgela
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mlcB (B:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mlcB (B:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgela
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mlcC (C:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mlcC (C:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgela
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mlcD (D:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mlcD (D:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgela
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mlcE (E:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mlcE (E:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgela