PDB entry 3mla

View 3mla on RCSB PDB site
Description: BaNadD in complex with inhibitor 1_02
Class: transferase
Keywords: NMNAT-inhibitor complex, TRANSFERASE
Deposited on 2010-04-16, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mlaa_
  • Chain 'B':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAMEG_4595, nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mlab_
  • Heterogens: JJZ, FMT, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mlaA (A:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mlaA (A:)
    mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml
    elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
    alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
    iernglye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mlaB (B:)
    gamrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlq
    mlelateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyn
    iealldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvq
    vyiernglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mlaB (B:)
    mrkigiiggtfdpphyghllianevyhalnleevwflpnqippnitsvesrlqmlelate
    aeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwyniealldl
    vtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvyierng
    lyes