PDB entry 3ml4

View 3ml4 on RCSB PDB site
Description: Crystal structure of a complex between Dok7 PH-PTB and the MuSK juxtamembrane region
Deposited on 2010-04-16, released 2010-07-14
The last revision was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.255
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Dok-7
    Species: Mus musculus [TaxId:10090]
    Gene: Dok7
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein Dok-7
    Species: Mus musculus [TaxId:10090]
    Gene: Dok7
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein Dok-7
    Species: Mus musculus [TaxId:10090]
    Gene: Dok7
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Protein Dok-7
    Species: Mus musculus [TaxId:10090]
    Gene: Dok7
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Muscle, skeletal receptor tyrosine-protein kinase
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Muscle, skeletal receptor tyrosine-protein kinase
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Muscle, skeletal receptor tyrosine-protein kinase
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Muscle, skeletal receptor tyrosine-protein kinase
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ml4A (A:)
    gsefmteaalvegqvklrdgkkwksrwlvlrkpspvadcllmlvykdkcerskglrerss
    ltledicglepalpyeglahtlaiiclsqavmlgfdsheamcawdtriryalgevhrfhv
    tvapgtklesgpatlhlcndilvlardipptvmgqwklsdlrrygavpngfifeggtrcg
    ywagvfflssaegeqmsflfdcivrgisptkgpfglrpvlpdps
    

    Sequence, based on observed residues (ATOM records):
    >3ml4A (A:)
    eaalvegqvklrkwksrwlvlrkpspvadcllmlvykdkcerskglrerssltledicgl
    epalpyeglahtlaiiclsqavmlgfdsheamcawdtriryalgevhrfhvtvapgtkle
    sgpatlhlcndilvlardipptvmgqwklsdlrrygavpngfifeggtrcgywagvffls
    saegeqmsflfdcivrgisptkgpf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ml4B (B:)
    gsefmteaalvegqvklrdgkkwksrwlvlrkpspvadcllmlvykdkcerskglrerss
    ltledicglepalpyeglahtlaiiclsqavmlgfdsheamcawdtriryalgevhrfhv
    tvapgtklesgpatlhlcndilvlardipptvmgqwklsdlrrygavpngfifeggtrcg
    ywagvfflssaegeqmsflfdcivrgisptkgpfglrpvlpdps
    

    Sequence, based on observed residues (ATOM records):
    >3ml4B (B:)
    mteaalvegqvklrkwksrwlvlrkpspvadcllmlvykdkcerskglrerssltledic
    glepalpyeglahtlaiiclsqavmlgfdsheamcawdtriryalgevhrfhvtvapgtk
    lesgpatlhlcndilvlardipptvmgqwklsdlrrygavpngfifeggtrcgywagvff
    lssaegeqmsflfdcivrgisptkgpf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3ml4C (C:)
    gsefmteaalvegqvklrdgkkwksrwlvlrkpspvadcllmlvykdkcerskglrerss
    ltledicglepalpyeglahtlaiiclsqavmlgfdsheamcawdtriryalgevhrfhv
    tvapgtklesgpatlhlcndilvlardipptvmgqwklsdlrrygavpngfifeggtrcg
    ywagvfflssaegeqmsflfdcivrgisptkgpfglrpvlpdps
    

    Sequence, based on observed residues (ATOM records):
    >3ml4C (C:)
    eaalvegqvklrdgkkwksrwlvlrkpspvadcllmlvykdkcerskglrerssltledi
    cglepalpyeglahtlaiiclsqavmlgfdsheamcawdtriryalgevhrfhvtvapgt
    klesgpatlhlcndilvlardipptvmgqwklsdlrrygavpngfifeggtrcgywagvf
    flssaegeqmsflfdcivrgisptkgpf
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3ml4D (D:)
    gsefmteaalvegqvklrdgkkwksrwlvlrkpspvadcllmlvykdkcerskglrerss
    ltledicglepalpyeglahtlaiiclsqavmlgfdsheamcawdtriryalgevhrfhv
    tvapgtklesgpatlhlcndilvlardipptvmgqwklsdlrrygavpngfifeggtrcg
    ywagvfflssaegeqmsflfdcivrgisptkgpfglrpvlpdps
    

    Sequence, based on observed residues (ATOM records):
    >3ml4D (D:)
    eaalvegqvklrdkwksrwlvlrkpspvadcllmlvykdkcerskglrerssltledicg
    lepalpyeglahtlaiiclsqavmlgfdsheamcawdtriryalgevhrfhvtvapgtkl
    esgpatlhlcndilvlardipptvmgqwklsdlrrygavpngfifeggtrcgywagvffl
    ssaegeqmsflfdcivrgisptkgpf
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3ml4E (E:)
    ldrlhpnpmyqrm
    

    Sequence, based on observed residues (ATOM records):
    >3ml4E (E:)
    lhpnpmyqr
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3ml4F (F:)
    ldrlhpnpmyqrm
    

    Sequence, based on observed residues (ATOM records):
    >3ml4F (F:)
    lhpnpmyqr
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3ml4G (G:)
    ldrlhpnpmyqrm
    

    Sequence, based on observed residues (ATOM records):
    >3ml4G (G:)
    lhpnpmyqr
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3ml4H (H:)
    ldrlhpnpmyqrm
    

    Sequence, based on observed residues (ATOM records):
    >3ml4H (H:)
    lhpnpmyqr