PDB entry 3ml3

View 3ml3 on RCSB PDB site
Description: Crystal structure of the IcsA autochaperone region
Deposited on 2010-04-16, released 2011-03-02
The last revision was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein icsA autotransporter
    Species: Shigella flexneri [TaxId:623]
    Gene: CP0182, icsA, virG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BCK4 (21-End)
      • expression tag (15-20)
      • see remark 999 (155)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ml3A (A:)
    mgsshhhhhhssglvprgshmsgtvlinninapflpdpvivtgnmtleknghvilnnsss
    nvgqtyvqkgnwhgkggilslgavlgndnsktdrleiaghasgityvavtneggsgdktl
    egvqiistdssdknafiqkgrivagsydyrlkqgtasglntnkwyltsqmdnqeskqmsn
    qestqmssr
    

    Sequence, based on observed residues (ATOM records):
    >3ml3A (A:)
    prgshmsgtvlinninapflpdpvivtgnmtleknghvilnnsssnvgqtyvqkgnwhgk
    ggilslgavlgndnsktdrleiaghasgityvavtneggsgdktlegvqiistdssdkna
    fiqkgrivagsydyrlkqgtasglntnkwyltsqmd