PDB entry 3ml0

View 3ml0 on RCSB PDB site
Description: Thermostable Penicillin G acylase from Alcaligenes faecalis in tetragonal form
Deposited on 2010-04-16, released 2010-05-05
The last revision was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.269
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin G acylase, alpha subunit
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: PAC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Penicillin G acylase, beta subunit
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: PAC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ml0A (A:)
    qvqsvevmrdsygvphvfadshyglyygygyavaqdrlfqmdmarrsfvgttaavlgpge
    qdayvkydmqvrqnftpasiqrqiaalskderdifrgyadgynayleqvrrrpellpkey
    vdfdfqpepltdfdvvmiwvgsmanrfsdtnlevtalamrqslekqhgpergralfdell
    windttapttvpapa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3ml0B (B:)
    snlwstrpervqegstvlingpqfgwynpaytygiglhgagfdvvgntpfaypivlfgtn
    seiawgatagpqdvvdiyqeklnpsradqywfnnawrtmeqrkeriqvrgqadremtiwr
    tvhgpvmqfdydqgaayskkrswdgyevqsllawlnvakarnwtefldqaskmaisinwy
    yadkhgnigyvspaflpqrpadqdirvpakgdgsmewlgiksfdaipkaynppqgylvnw
    nnkpapdktntdtyywtygdrmnelvsqyqqkdlfsvqeiwefnqkasysdvnwryfrph
    leklaqqlpaddsskaaltmllawdgmeqdqggqnagparvlfktwleemykqvlmpvvp
    eshramysqtgfatqqgpnpgsinlsmgtkvllralvleahpdpkrvnvfgerssqeimh
    talqnaqarlsqeqgaqmarwtmptsvhrfsdknftgtpqtmpgntfaftgyqnrgtenn
    rvvfdakgvefcdamppgqsgftdrngvrsphyedqlklyenfecktmdvthadirrnaq
    sstmlliqpqp