PDB entry 3mky

View 3mky on RCSB PDB site
Description: Structure of SopB(155-323)-18mer DNA complex, I23 form
Deposited on 2010-04-15, released 2010-05-05
The last revision was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.242
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Protein sopB
    Species: Escherichia coli [TaxId:83333]
    Gene: B, ECOK12F047, plasmid, sopB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62558
      • conflict (120)
  • Chain 'P':
    Compound: Protein sopB
    Species: Escherichia coli [TaxId:83333]
    Gene: B, ECOK12F047, plasmid, sopB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62558
      • conflict (120)
  • Chain 'T':
    Compound: DNA (5'-d(*cp*tp*gp*gp*gp*ap*cp*cp*ap*tp*gp*gp*tp*cp*cp*cp*ap*g)-3')
    Species: synthetic, synthetic
  • Chain 'U':
    Compound: DNA (5'-d(*cp*tp*gp*gp*gp*ap*cp*cp*ap*tp*gp*gp*tp*cp*cp*cp*ap*g)-3')
    Species: synthetic, synthetic
  • Heterogens: SO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mkyB (B:)
    mgsshhhhhhssglvprgshyrptsayergqryasrlqnefagnisaladaenisrkiit
    rcintaklpksvvalfshpgelsarsgdalqkaftdkeellkqqasnlheqkkagvifea
    devitlltsvlktssasrtslssrhqfapgatvlykgdkmvlnldrsrvpteciekieai
    lkelekpap
    

    Sequence, based on observed residues (ATOM records):
    >3mkyB (B:)
    ptsayergqryasrlqnefagnisaladaenisrkiitrcintaklpksvvalfshpgel
    sarsgdalqkaftdkeellkqqasnlheqkkagvifeadevitlltsvlktssas
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3mkyP (P:)
    mgsshhhhhhssglvprgshyrptsayergqryasrlqnefagnisaladaenisrkiit
    rcintaklpksvvalfshpgelsarsgdalqkaftdkeellkqqasnlheqkkagvifea
    devitlltsvlktssasrtslssrhqfapgatvlykgdkmvlnldrsrvpteciekieai
    lkelekpap
    

    Sequence, based on observed residues (ATOM records):
    >3mkyP (P:)
    ptsayergqryasrlqnefagnisaladaenisrkiitrcintaklpksvvalfshpgel
    sarsgdalqkaftdkeellkqqasnlheqkkagvifeadevitlltsvlktssa
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.