PDB entry 3mkx

View 3mkx on RCSB PDB site
Description: Crystal Structure of BST2/Tetherin
Deposited on 2010-04-15, released 2010-05-05
The last revision was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.265
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mkxA (A:)
    gidpftkanseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkk
    

    Sequence, based on observed residues (ATOM records):
    >3mkxA (A:)
    anseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalmasldaeka
    qgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mkxB (B:)
    gidpftkanseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkk
    

    Sequence, based on observed residues (ATOM records):
    >3mkxB (B:)
    kanseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalmasldaek
    aqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mkxC (C:)
    gidpftkanseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkk
    

    Sequence, based on observed residues (ATOM records):
    >3mkxC (C:)
    anseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalmasldaeka
    qgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mkxD (D:)
    gidpftkanseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkk
    

    Sequence, based on observed residues (ATOM records):
    >3mkxD (D:)
    seacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalmasldaekaqg
    qkkveelegeittlnhklqdasaeverlrrenqvlsvriad