PDB entry 3mkv

View 3mkv on RCSB PDB site
Description: Crystal structure of amidohydrolase eaj56179
Class: hydrolase
Keywords: SARGASSO SEA, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, PROLIDASE, HYDROLASE, New York SGX Research Center for Structural Genomics
Deposited on 2010-04-15, released 2010-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.173
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative amidohydrolase
    Species: unidentified [TaxId:32644]
    Gene: EAJ56179
    Database cross-references and differences (RAF-indexed):
    • PDB 3MKV
    Domains in SCOPe 2.07: d3mkva1, d3mkva2
  • Chain 'B':
    Compound: putative amidohydrolase
    Species: unidentified [TaxId:32644]
    Gene: EAJ56179
    Database cross-references and differences (RAF-indexed):
    • PDB 3MKV
    Domains in SCOPe 2.07: d3mkvb1, d3mkvb2
  • Chain 'C':
    Compound: putative amidohydrolase
    Species: unidentified [TaxId:32644]
    Gene: EAJ56179
    Database cross-references and differences (RAF-indexed):
    • PDB 3MKV
    Domains in SCOPe 2.07: d3mkvc1, d3mkvc2
  • Chain 'D':
    Compound: putative amidohydrolase
    Species: unidentified [TaxId:32644]
    Gene: EAJ56179
    Database cross-references and differences (RAF-indexed):
    • PDB 3MKV
    Domains in SCOPe 2.07: d3mkvd1, d3mkvd2
  • Chain 'E':
    Compound: putative amidohydrolase
    Species: unidentified [TaxId:32644]
    Gene: EAJ56179
    Database cross-references and differences (RAF-indexed):
    • PDB 3MKV
    Domains in SCOPe 2.07: d3mkve1, d3mkve2
  • Chain 'F':
    Compound: putative amidohydrolase
    Species: unidentified [TaxId:32644]
    Gene: EAJ56179
    Database cross-references and differences (RAF-indexed):
    • PDB 3MKV
    Domains in SCOPe 2.07: d3mkvf1, d3mkvf2
  • Chain 'G':
    Compound: putative amidohydrolase
    Species: unidentified [TaxId:32644]
    Gene: EAJ56179
    Database cross-references and differences (RAF-indexed):
    • PDB 3MKV
    Domains in SCOPe 2.07: d3mkvg1, d3mkvg2
  • Chain 'H':
    Compound: putative amidohydrolase
    Species: unidentified [TaxId:32644]
    Gene: EAJ56179
    Database cross-references and differences (RAF-indexed):
    • PDB 3MKV
    Domains in SCOPe 2.07: d3mkvh1, d3mkvh2
  • Heterogens: ZN, SO4, GOL, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mkvA (A:)
    mslttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpg
    lidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqave
    sglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrra
    vreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaa
    iaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiaki
    advhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsa
    evlgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnelegheg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkvA (A:)
    lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpgli
    dlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqavesg
    lvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravr
    eelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaaia
    ravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiakiad
    vhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsaev
    lgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mkvB (B:)
    mslttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpg
    lidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqave
    sglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrra
    vreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaa
    iaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiaki
    advhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsa
    evlgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnelegheg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkvB (B:)
    ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpglid
    lhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqavesgl
    vegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravre
    elqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaaiar
    avrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiakiadv
    hgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsaevl
    gmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mkvC (C:)
    mslttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpg
    lidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqave
    sglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrra
    vreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaa
    iaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiaki
    advhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsa
    evlgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnelegheg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkvC (C:)
    ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpglid
    lhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqavesgl
    vegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravre
    elqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaaiar
    avrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiakiadv
    hgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsaevl
    gmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mkvD (D:)
    mslttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpg
    lidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqave
    sglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrra
    vreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaa
    iaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiaki
    advhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsa
    evlgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnelegheg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkvD (D:)
    ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpglid
    lhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqavesgl
    vegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravre
    elqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaaiar
    avrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiakiadv
    hgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsaevl
    gmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mkvE (E:)
    mslttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpg
    lidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqave
    sglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrra
    vreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaa
    iaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiaki
    advhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsa
    evlgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnelegheg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkvE (E:)
    ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpglid
    lhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqavesgl
    vegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravre
    elqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaaiar
    avrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiakiadv
    hgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsaevl
    gmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mkvF (F:)
    mslttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpg
    lidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqave
    sglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrra
    vreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaa
    iaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiaki
    advhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsa
    evlgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnelegheg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkvF (F:)
    ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpglid
    lhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqavesgl
    vegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravre
    elqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaaiar
    avrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiakiadv
    hgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsaevl
    gmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mkvG (G:)
    mslttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpg
    lidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqave
    sglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrra
    vreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaa
    iaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiaki
    advhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsa
    evlgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnelegheg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkvG (G:)
    ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpglid
    lhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqavesgl
    vegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravre
    elqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaaiar
    avrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiakiadv
    hgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsaevl
    gmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mkvH (H:)
    mslttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpg
    lidlhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqave
    sglvegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrra
    vreelqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaa
    iaravrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiaki
    advhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsa
    evlgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnelegheg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkvH (H:)
    ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpglid
    lhvhvvaiefnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqavesgl
    vegprlfvsgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravre
    elqmgadqikimasggvasptdpvgvfgysedeiraivaeaqgrgtyvlahaytpaaiar
    avrcgvrtiehgnliddetarlvaehgayvvptlvtydalasegekyglppesiakiadv
    hgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevlspaeviasativsaevl
    gmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele