PDB entry 3mku

View 3mku on RCSB PDB site
Description: Structure of a Cation-bound Multidrug and Toxin Compound Extrusion (MATE) transporter
Class: transport protein
Keywords: MATE, multidrug transporter, cation-bound, TRANSPORT PROTEIN
Deposited on 2010-04-15, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.309
AEROSPACI score: -0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux pump
    Species: Vibrio cholerae [TaxId:243277]
    Gene: NorM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkua_
  • Chain 'B':
    Compound: Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux pump
    Species: Vibrio cholerae [TaxId:243277]
    Gene: NorM
    Database cross-references and differences (RAF-indexed):
  • Heterogens: RB

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mkuA (A:)
    ensvhrykkeasnliklatpvliasvaqtgmgfvdtimaggvsaidmaavsiaasiwlps
    ilfgvgllmalvpvvaqlngagrqhkipfevhqglilallvsvpiiavlfqtqfiirfmd
    veeamatktvgymhavifavpayllfqalrsftdgmsltkpamvigfiglllniplnwif
    vygkfgapelggvgcgvataivywimlllllfyivtskrlahvkvfetfhkpqpkelirl
    frlgfpvaaalffevtlfavvallvaplgstvvaahqvalnfsslvfmfpmsigaavsir
    vghklgeqdtkgaaiaanvglmtglatacitalltvlfreqiallytenqvvvalamqll
    lfaaiyqcmdavqvvaagslrgykdmtaifhrtfisywvlglptgyilgmtnwlteqplg
    akgfwlgfiiglsaaalmlgqrlywlqkqsddvqlhlaak
    

  • Chain 'B':
    No sequence available.