PDB entry 3mkt

View 3mkt on RCSB PDB site
Description: Structure of a Cation-bound Multidrug and Toxin Compound Extrusion (MATE) transporter
Deposited on 2010-04-15, released 2010-09-29
The last revision was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 3.65 Å
R-factor: 0.312
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux pump
    Species: Vibrio cholerae [TaxId:243277]
    Gene: NorM
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux pump
    Species: Vibrio cholerae [TaxId:243277]
    Gene: NorM
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mktA (A:)
    ensvhrykkeasnliklatpvliasvaqtgmgfvdtimaggvsaidmaavsiaasiwlps
    ilfgvgllmalvpvvaqlngagrqhkipfevhqglilallvsvpiiavlfqtqfiirfmd
    veeamatktvgymhavifavpayllfqalrsftdgmsltkpamvigfiglllniplnwif
    vygkfgapelggvgcgvataivywimlllllfyivtskrlahvkvfetfhkpqpkelirl
    frlgfpvaaalffevtlfavvallvaplgstvvaahqvalnfsslvfmfpmsigaavsir
    vghklgeqdtkgaaiaanvglmtglatacitalltvlfreqiallytenqvvvalamqll
    lfaaiyqcmdavqvvaagslrgykdmtaifhrtfisywvlglptgyilgmtnwlteqplg
    akgfwlgfiiglsaaalmlgqrlywlqkqsddvqlhlaak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mktB (B:)
    ensvhrykkeasnliklatpvliasvaqtgmgfvdtimaggvsaidmaavsiaasiwlps
    ilfgvgllmalvpvvaqlngagrqhkipfevhqglilallvsvpiiavlfqtqfiirfmd
    veeamatktvgymhavifavpayllfqalrsftdgmsltkpamvigfiglllniplnwif
    vygkfgapelggvgcgvataivywimlllllfyivtskrlahvkvfetfhkpqpkelirl
    frlgfpvaaalffevtlfavvallvaplgstvvaahqvalnfsslvfmfpmsigaavsir
    vghklgeqdtkgaaiaanvglmtglatacitalltvlfreqiallytenqvvvalamqll
    lfaaiyqcmdavqvvaagslrgykdmtaifhrtfisywvlglptgyilgmtnwlteqplg
    akgfwlgfiiglsaaalmlgqrlywlqkqsddvqlhlaak