PDB entry 3mkr

View 3mkr on RCSB PDB site
Description: Crystal structure of yeast alpha/epsilon-COP subcomplex of the COPI vesicular coat
Deposited on 2010-04-15, released 2010-07-14
The last revision was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coatomer subunit epsilon
    Species: Bos taurus [TaxId:9913]
    Gene: COPE, COPE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28104 (0-290)
      • variant (77)
  • Chain 'B':
    Compound: Coatomer subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: CopA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mkrA (A:)
    delfdvknafyigsyqqcineaqrvkpssperdverdvflyraylaqrkygvvldeikps
    sapelqavrmfaeylashsrrdaivaeldremsrsvdvtnttfllmaasiyfydqnpdaa
    lrtlhqgdslecmamtvqillkldrldlarkelkkmqdqdedatltqlatawvslaagge
    klqdayyifqemadkcsptllllngqaachmaqgrweaaegvlqealdkdsghpetlinl
    vvlsqhlgkppevtnrylsqlkdahrshpfikeyrakendfdrlvlqyaps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mkrB (B:)
    gffvpptkgtsptqiwcnnsqlpvdhilagsfetamrllhdqvgvtqfgpykqlflqtya
    rgrttyqalpclpsmygypnrnwkdaglkngvpavglklndliqrlqlcyqlttvgkfee
    avekfrsillsvpllvvdnkqeiaeaqqliticreyivglsmeterkklpketleqqkri
    cemaayfthsnlqpvhmilvlrtalnlffklknfrtaaafarrllelgpkpevaqqtrki
    lsaceknptdayqlnydmhnpfdicaasyrpiyrgkpvekcplsgacyspefkgqickvt
    tvteigkdviglrisplqfr