PDB entry 3mkq

View 3mkq on RCSB PDB site
Description: Crystal structure of yeast alpha/betaprime-COP subcomplex of the COPI vesicular coat
Deposited on 2010-04-15, released 2010-07-14
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coatomer beta'-subunit
    Species: Saccharomyces cerevisiae [TaxId:307796]
    Gene: SEC27, SCY_1929
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6ZU46
      • variant (700)
  • Chain 'B':
    Compound: Coatomer subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RET1, COP1, SEC33, YDL145C, D1578
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53622 (0-176)
      • variant (22)
      • variant (34)
  • Chain 'C':
    Compound: Coatomer beta'-subunit
    Species: Saccharomyces cerevisiae [TaxId:307796]
    Gene: SEC27, SCY_1929
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6ZU46 (Start-813)
      • variant (700)
  • Chain 'D':
    Compound: Coatomer subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RET1, COP1, SEC33, YDL145C, D1578
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53622 (0-176)
      • variant (22)
      • variant (34)
  • Chain 'E':
    Compound: Coatomer beta'-subunit
    Species: Saccharomyces cerevisiae [TaxId:307796]
    Gene: SEC27, SCY_1929
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6ZU46 (0-End)
      • variant (700)
  • Chain 'F':
    Compound: Coatomer subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RET1, COP1, SEC33, YDL145C, D1578
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53622 (0-End)
      • variant (22)
      • variant (34)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mkqA (A:)
    mkldikktfsnrsdrvkgidfhptepwvlttlysgrveiwnyetqvevrsiqvtetpvra
    gkfiarknwiivgsddfrirvfnyntgekvvdfeahpdyirsiavhptkpyvlsgsddlt
    vklwnwennwaleqtfeghehfvmcvafnpkdpstfasgcldrtvkvwslgqstpnftlt
    tgqergvnyvdyyplpdkpymitasddltikiwdyqtkscvatleghmsnvsfavfhptl
    piiisgsedgtlkiwnsstykvektlnvglerswciathptgrknyiasgfdngftvlsl
    gndeptlsldpvgklvwsggknaaasdiftavirgneeveqdeplslqtkelgsvdvfpq
    slahspngrfvtvvgdgeyviytalawrnkafgkcqdfvwgpdsnsyalidetgqikyyk
    nfkevtswsvpmhsaidrlfsgallgvksdgfvyffdwdngtlvrridvnakdviwsdng
    elvmivntnsngdeasgytllfnkdayleaanngniddsegvdeafdvlyelsesitsgk
    wvgdvfifttatnrlnyfvggktynlahytkemyllgylardnkvyladrevhvygyeis
    levlefqtltlrgeieeaienvlpnvegkdsltkiarflegqeyyeealnispdqdqkfe
    lalkvgqltlardlltdesaemkwralgdaslqrfnfklaieaftnahdleslfllhssf
    nnkeglvtlakdaettgkfnlafnaywiagdiqgakdlliksqrfseaaflgstyglgdn
    evndivtkwkenlilngkntvservcgaeglpgs
    

    Sequence, based on observed residues (ATOM records):
    >3mkqA (A:)
    kldikktfsnrsdrvkgidfhptepwvlttlysgrveiwnyetqvevrsiqvtetpvrag
    kfiarknwiivgsddfrirvfnyntgekvvdfeahpdyirsiavhptkpyvlsgsddltv
    klwnwennwaleqtfeghehfvmcvafnpkdpstfasgcldrtvkvwslgqstpnftltt
    gqergvnyvdyyplpdkpymitasddltikiwdyqtkscvatleghmsnvsfavfhptlp
    iiisgsedgtlkiwnsstykvektlnvglerswciathptgrknyiasgfdngftvlslg
    ndeptlsldpvgklvwsggknaaasdiftavirgneeveqdeplslqtkelgsvdvfpqs
    lahspngrfvtvvgdgeyviytalawrnkafgkcqdfvwgpdsnsyalidetgqikyykn
    fkevtswsvpmhsaidrlfsgallgvksdgfvyffdwdngtlvrridvnakdviwsdnge
    lvmivntnsngdeasgytllfnkdayleaanngniddsegvdeafdvlyelsesitsgkw
    vgdvfifttatnrlnyfvggktynlahytkemyllgylardnkvyladrevhvygyeisl
    evlefqtltlrgeieeaienvlpnvegkdsltkiarflegqeyyeealnispdqdqkfel
    alkvgqltlardlltdesaemkwralgdaslqrfnfklaieaftnahdleslfllhssfn
    nkeglvtlakdaettgkfnlafnaywiagdiqgakdlliksqrfseaaflgstyglgdne
    vndivtkwkenlilngkntvservcgaeglp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mkqB (B:)
    alqfvqdphirfdlaleygnldaaldeakklndsitwerliqealaqgnaslaemiyqtq
    hsfdklsflylvtgdvnklskmqniaqtredfgsmllntfynnstkerssifaeggslpl
    ayavakangdeaaasafleqaevdeqdvtlpdqmdasnfvqrpviskplekwplkea
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mkqC (C:)
    mkldikktfsnrsdrvkgidfhptepwvlttlysgrveiwnyetqvevrsiqvtetpvra
    gkfiarknwiivgsddfrirvfnyntgekvvdfeahpdyirsiavhptkpyvlsgsddlt
    vklwnwennwaleqtfeghehfvmcvafnpkdpstfasgcldrtvkvwslgqstpnftlt
    tgqergvnyvdyyplpdkpymitasddltikiwdyqtkscvatleghmsnvsfavfhptl
    piiisgsedgtlkiwnsstykvektlnvglerswciathptgrknyiasgfdngftvlsl
    gndeptlsldpvgklvwsggknaaasdiftavirgneeveqdeplslqtkelgsvdvfpq
    slahspngrfvtvvgdgeyviytalawrnkafgkcqdfvwgpdsnsyalidetgqikyyk
    nfkevtswsvpmhsaidrlfsgallgvksdgfvyffdwdngtlvrridvnakdviwsdng
    elvmivntnsngdeasgytllfnkdayleaanngniddsegvdeafdvlyelsesitsgk
    wvgdvfifttatnrlnyfvggktynlahytkemyllgylardnkvyladrevhvygyeis
    levlefqtltlrgeieeaienvlpnvegkdsltkiarflegqeyyeealnispdqdqkfe
    lalkvgqltlardlltdesaemkwralgdaslqrfnfklaieaftnahdleslfllhssf
    nnkeglvtlakdaettgkfnlafnaywiagdiqgakdlliksqrfseaaflgstyglgdn
    evndivtkwkenlilngkntvservcgaeglpgs
    

    Sequence, based on observed residues (ATOM records):
    >3mkqC (C:)
    kldikktfsnrsdrvkgidfhptepwvlttlysgrveiwnyetqvevrsiqvtetpvrag
    kfiarknwiivgsddfrirvfnyntgekvvdfeahpdyirsiavhptkpyvlsgsddltv
    klwnwennwaleqtfeghehfvmcvafnpkdpstfasgcldrtvkvwslgqstpnftltt
    gqergvnyvdyyplpdkpymitasddltikiwdyqtkscvatleghmsnvsfavfhptlp
    iiisgsedgtlkiwnsstykvektlnvglerswciathptgrknyiasgfdngftvlslg
    ndeptlsldpvgklvwsggknaaasdiftavirgneeveqdeplslqtkelgsvdvfpqs
    lahspngrfvtvvgdgeyviytalawrnkafgkcqdfvwgpdsnsyalidetgqikyykn
    fkevtswsvpmhsaidrlfsgallgvksdgfvyffdwdngtlvrridvnakdviwsdnge
    lvmivntnsneasgytllfnkdayleaanngniddsegvdeafdvlyelsesitsgkwvg
    dvfifttatnrlnyfvggktynlahytkemyllgylardnkvyladrevhvygyeislev
    lefqtltlrgeieeaienvlpnvegkdsltkiarflegqeyyeealnispdqdqkfelal
    kvgqltlardlltdesaemkwralgdaslqrfnfklaieaftnahdleslfllhssfnnk
    eglvtlakdaettgkfnlafnaywiagdiqgakdlliksqrfseaaflgstyglgdnevn
    divtkwkenlilngkntvservcgaeglpgs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3mkqD (D:)
    alqfvqdphirfdlaleygnldaaldeakklndsitwerliqealaqgnaslaemiyqtq
    hsfdklsflylvtgdvnklskmqniaqtredfgsmllntfynnstkerssifaeggslpl
    ayavakangdeaaasafleqaevdeqdvtlpdqmdasnfvqrpviskplekwplkea
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mkqE (E:)
    mkldikktfsnrsdrvkgidfhptepwvlttlysgrveiwnyetqvevrsiqvtetpvra
    gkfiarknwiivgsddfrirvfnyntgekvvdfeahpdyirsiavhptkpyvlsgsddlt
    vklwnwennwaleqtfeghehfvmcvafnpkdpstfasgcldrtvkvwslgqstpnftlt
    tgqergvnyvdyyplpdkpymitasddltikiwdyqtkscvatleghmsnvsfavfhptl
    piiisgsedgtlkiwnsstykvektlnvglerswciathptgrknyiasgfdngftvlsl
    gndeptlsldpvgklvwsggknaaasdiftavirgneeveqdeplslqtkelgsvdvfpq
    slahspngrfvtvvgdgeyviytalawrnkafgkcqdfvwgpdsnsyalidetgqikyyk
    nfkevtswsvpmhsaidrlfsgallgvksdgfvyffdwdngtlvrridvnakdviwsdng
    elvmivntnsngdeasgytllfnkdayleaanngniddsegvdeafdvlyelsesitsgk
    wvgdvfifttatnrlnyfvggktynlahytkemyllgylardnkvyladrevhvygyeis
    levlefqtltlrgeieeaienvlpnvegkdsltkiarflegqeyyeealnispdqdqkfe
    lalkvgqltlardlltdesaemkwralgdaslqrfnfklaieaftnahdleslfllhssf
    nnkeglvtlakdaettgkfnlafnaywiagdiqgakdlliksqrfseaaflgstyglgdn
    evndivtkwkenlilngkntvservcgaeglpgs
    

    Sequence, based on observed residues (ATOM records):
    >3mkqE (E:)
    mkldikktfsnrsdrvkgidfhptepwvlttlysgrveiwnyetqvevrsiqvtetpvra
    gkfiarknwiivgsddfrirvfnyntgekvvdfeahpdyirsiavhptkpyvlsgsddlt
    vklwnwennwaleqtfeghehfvmcvafnpkdpstfasgcldrtvkvwslgqstpnftlt
    tgqergvnyvdyyplpdkpymitasddltikiwdyqtkscvatleghmsnvsfavfhptl
    piiisgsedgtlkiwnsstykvektlnvglerswciathptgrknyiasgfdngftvlsl
    gndeptlsldpvgklvwsggknaaasdiftavirgneeveqdeplslqtkelgsvdvfpq
    slahspngrfvtvvgdgeyviytalawrnkafgkcqdfvwgpdsnsyalidetgqikyyk
    nfkevtswsvpmhsaidrlfsgallgvksdgfvyffdwdngtlvrridvnakdviwsdng
    elvmivntnseasgytllfnkdayleaanngniddsegvdeafdvlyelsesitsgkwvg
    dvfifttatnrlnyfvggktynlahytkemyllgylardnkvyladrevhvygyeislev
    lefqtltlrgeieeaienvlpnvegkdsltkiarflegqeyyeealnispdqdqkfelal
    kvgqltlardlltdesaemkwralgdaslqrfnfklaieaftnahdleslfllhssfnnk
    eglvtlakdaettgkfnlafnaywiagdiqgakdlliksqrfseaaflgstyglgdnevn
    divtkwkenlilngkntvservcgaeglpg
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mkqF (F:)
    alqfvqdphirfdlaleygnldaaldeakklndsitwerliqealaqgnaslaemiyqtq
    hsfdklsflylvtgdvnklskmqniaqtredfgsmllntfynnstkerssifaeggslpl
    ayavakangdeaaasafleqaevdeqdvtlpdqmdasnfvqrpviskplekwplkea
    

    Sequence, based on observed residues (ATOM records):
    >3mkqF (F:)
    alqfvqdphirfdlaleygnldaaldeakklndsitwerliqealaqgnaslaemiyqtq
    hsfdklsflylvtgdvnklskmqniaqtredfgsmllntfynnstkerssifaeggslpl
    ayavakangdeaaasafleqaevdeqdvtlpdqmdasnfvqrpviskplekwplk