PDB entry 3mkn

View 3mkn on RCSB PDB site
Description: Crystal structure of the E. coli pyrimidine nucleosidase YeiK bound to a competitive inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Pyrimidine nucleoside hydrolase, nucleotide metabolism, enzyme-inhibitor complex, metalloenzyme, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-04-15, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein YeiK
    Species: Escherichia coli [TaxId:83333]
    Gene: YEIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkna_
  • Chain 'B':
    Compound: Putative uncharacterized protein YeiK
    Species: Escherichia coli [TaxId:83333]
    Gene: YEIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mknb_
  • Chain 'C':
    Compound: Putative uncharacterized protein YeiK
    Species: Escherichia coli [TaxId:83333]
    Gene: YEIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mknc_
  • Chain 'D':
    Compound: Putative uncharacterized protein YeiK
    Species: Escherichia coli [TaxId:83333]
    Gene: YEIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mknd_
  • Heterogens: CA, DNB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mknA (A:)
    gshmekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkl
    einvpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdg
    ditlvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvv
    ftsgvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggp
    vhdatcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdw
    fwglveecvrgyikth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mknA (A:)
    krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
    vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv
    pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv
    plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfepvhdatcigylin
    pdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglveecvrgy
    ikt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mknB (B:)
    gshmekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkl
    einvpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdg
    ditlvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvv
    ftsgvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggp
    vhdatcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdw
    fwglveecvrgyikth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mknB (B:)
    krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
    vyagmpqpimrqqivagldgpvfepltrqaesthavkyiidtlmasdgditlvpvgplsn
    iavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgvplvmmgl
    dltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdatcigylin
    pdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglveecvrgy
    i
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mknC (C:)
    gshmekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkl
    einvpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdg
    ditlvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvv
    ftsgvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggp
    vhdatcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdw
    fwglveecvrgyikth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mknC (C:)
    krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
    vyagmpqpimrqqivadtgldgpvfepltrqaesthavkyiidtlmasdgditlvpvgpl
    sniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgvplvmm
    gldltnqtvctpdviarmeraggpagelfsdimnftgpvhdatcigylinpdgiktqemy
    vevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglveecvrgyik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mknD (D:)
    gshmekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkl
    einvpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdg
    ditlvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvv
    ftsgvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggp
    vhdatcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdw
    fwglveecvrgyikth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mknD (D:)
    krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
    vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv
    pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv
    plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfegpvhdatcigyli
    npdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglveecvrg
    yik