PDB entry 3mkm

View 3mkm on RCSB PDB site
Description: Crystal structure of the E. coli pyrimidine nucleoside hydrolase YeiK (Apo-form)
Class: hydrolase
Keywords: pyrimidine nucleoside hydrolase, bacterial nucleosidase, nucleotide metabolism, metalloenzyme, hydrolase
Deposited on 2010-04-15, released 2010-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein YeiK
    Species: Escherichia coli [TaxId:83333]
    Gene: YEIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3mkma_
  • Chain 'B':
    Compound: Putative uncharacterized protein YeiK
    Species: Escherichia coli [TaxId:83333]
    Gene: YEIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3mkmb_
  • Chain 'C':
    Compound: Putative uncharacterized protein YeiK
    Species: Escherichia coli [TaxId:83333]
    Gene: YEIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3mkmc_
  • Chain 'D':
    Compound: Putative uncharacterized protein YeiK
    Species: Escherichia coli [TaxId:83333]
    Gene: YEIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3mkmd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mkmA (A:)
    gshmekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkl
    einvpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdg
    ditlvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvv
    ftsgvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggp
    vhdatcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdw
    fwglveecvrgyikth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkmA (A:)
    mekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqklein
    vpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgdit
    lvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvfts
    gvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhd
    atcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwg
    lveecvrgyik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mkmB (B:)
    gshmekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkl
    einvpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdg
    ditlvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvv
    ftsgvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggp
    vhdatcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdw
    fwglveecvrgyikth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkmB (B:)
    ekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinv
    pvyagmpqpimrqqivaddtgldgpvfepltrqaesthavkyiidtlmasdgditlvpvg
    plsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgvplv
    mmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfeaggpvhdatcigylin
    pdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglveecvrgy
    ik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mkmC (C:)
    gshmekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkl
    einvpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdg
    ditlvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvv
    ftsgvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggp
    vhdatcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdw
    fwglveecvrgyikth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkmC (C:)
    krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
    vyagmpqpimrqqivadtgldgpvfepltrqaesthavkyiidtlmasdgditlvpvgpl
    sniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgvplvmm
    gldltnqtvctpdviarmeraggpagelfsdimnftlkggpvhdatcigylinpdgiktq
    emyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglveecvrgyik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mkmD (D:)
    gshmekrkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkl
    einvpvyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdg
    ditlvpvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvv
    ftsgvplvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggp
    vhdatcigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdw
    fwglveecvrgyikth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkmD (D:)
    krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
    vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv
    pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv
    plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdat
    cigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglv
    eecvrgyik