PDB entry 3mkl

View 3mkl on RCSB PDB site
Description: crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12
Deposited on 2010-04-15, released 2010-04-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator gadX
    Species: Escherichia coli [TaxId:83333]
    Gene: gadX, yhiX, b3516, JW3484
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: HTH-type transcriptional regulator gadX
    Species: Escherichia coli [TaxId:83333]
    Gene: gadX, yhiX, b3516, JW3484
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37639 (1-End)
      • expression tag (0)
      • conflict (2)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mklA (A:)
    snalqpnmrtrvctvinnniahewtlariasellmspsllkkklreeetsysqlltecrm
    qralqlivihgfsikrvavscgyhsvsyfiyvfrnyygmtpteyqersaqrlsnrdsaas
    

    Sequence, based on observed residues (ATOM records):
    >3mklA (A:)
    qpnmrtrvctvinnniahewtlariasellmspsllkkklreeetsysqlltecrmqral
    qlivihgfsikrvavscgyhsvsyfiyvfrnyygmtpteyqers
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mklB (B:)
    snalqpnmrtrvctvinnniahewtlariasellmspsllkkklreeetsysqlltecrm
    qralqlivihgfsikrvavscgyhsvsyfiyvfrnyygmtpteyqersaqrlsnrdsaas
    

    Sequence, based on observed residues (ATOM records):
    >3mklB (B:)
    snalqpnmrtrvctvinnniahewtlariasellmspsllkkklreeetsysqlltecrm
    qralqlivihgfsikrvavscgyhsvsyfiyvfrnyygmtpteyqersaqr