PDB entry 3mkk

View 3mkk on RCSB PDB site
Description: the crystal structure of the d307a mutant of glycoside hydrolase (family 31) from ruminococcus obeum atcc 29174 in complex with isomaltose
Deposited on 2010-04-15, released 2010-06-23
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-glucosidase GH31 family
    Species: Ruminococcus obeum [TaxId:411459]
    Gene: RUMOBE_03919
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5ZY13 (3-665)
      • expression tag (2)
      • engineered (309)
  • Chain 'B':
    Compound: alpha-glucosidase GH31 family
    Species: Ruminococcus obeum [TaxId:411459]
    Gene: RUMOBE_03919
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5ZY13 (3-665)
      • expression tag (2)
      • engineered (309)
  • Heterogens: GLC, BGC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mkkA (A:)
    snamirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesn
    rginkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytr
    mdtlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedf
    ravakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiida
    gvkvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrfli
    dqgiegfwnamnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedy
    krfyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiw
    mgdnkswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrd
    haaegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddk
    mairvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvd
    valnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkken
    yrvltk
    

    Sequence, based on observed residues (ATOM records):
    >3mkkA (A:)
    amirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesnrg
    inkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytrmd
    tlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedfra
    vakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiidagv
    kvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrflidq
    giegfwnamnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedykr
    fyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiwmg
    dnkswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrdha
    aegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddkma
    irvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvdva
    lnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkkenyr
    vltk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mkkB (B:)
    snamirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesn
    rginkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytr
    mdtlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedf
    ravakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiida
    gvkvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrfli
    dqgiegfwnamnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedy
    krfyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiw
    mgdnkswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrd
    haaegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddk
    mairvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvd
    valnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkken
    yrvltk
    

    Sequence, based on observed residues (ATOM records):
    >3mkkB (B:)
    amirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesnrg
    inkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytrmd
    tlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedfra
    vakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiidagv
    kvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrflidq
    giegfwnamnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedykr
    fyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiwmg
    dnkswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrdha
    aegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddkma
    irvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvdva
    lnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkkenyr
    vltk