PDB entry 3mkj

View 3mkj on RCSB PDB site
Description: Methionine gamma-lyase from Citrobacter freundii with pyridoximine-5'-phosphate
Class: lyase
Keywords: Pyridoxal-5'-phosphate, PLP-dependent enzyme, lyase, X-ray damage
Deposited on 2010-04-15, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: megL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84AR1 (Start-397)
      • see remark 999 (131-132)
      • see remark 999 (136)
    Domains in SCOPe 2.07: d3mkja_
  • Heterogens: PZP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mkjA (A:)
    msdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytr
    lgnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafl
    shsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqga
    llvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkd
    itggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqye
    lgqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvap
    eerlkagitdglirlsvgledpediindlehairkatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkjA (A:)
    sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarflgnpttdalekk
    lavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthaflshsmpkfginvs
    fvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgallvvdntfmspy
    cqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkditggcmspfnaw
    ltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyelgqrqmslpggi
    isfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvapeerlkagitdgl
    irlsvgledpediindlehairkatf