PDB entry 3mki

View 3mki on RCSB PDB site
Description: Crystal Structure of Ketosteroid Isomerase D38ED99N from Pseudomonas Testosteroni (tKSI)
Class: isomerase
Keywords: Steroid Metabolism, Isomerase
Deposited on 2010-04-14, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-End)
      • engineered (37)
      • engineered (98)
    Domains in SCOPe 2.07: d3mkia_
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-End)
      • engineered (37)
      • engineered (98)
    Domains in SCOPe 2.07: d3mkib_
  • Chain 'C':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-End)
      • engineered (37)
      • engineered (98)
    Domains in SCOPe 2.07: d3mkic_
  • Chain 'D':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-End)
      • engineered (37)
      • engineered (98)
    Domains in SCOPe 2.07: d3mkid_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mkiA (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkiA (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mkiB (B:)
    mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkiB (B:)
    mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mkiC (C:)
    mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkiC (C:)
    mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mkiD (D:)
    mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkiD (D:)
    mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihag