PDB entry 3mkh

View 3mkh on RCSB PDB site
Description: Podospora anserina Nitroalkane Oxidase
Class: oxidoreductase
Keywords: oxidoreductase flavoenzyme, nitroalkane, acyl-coa dehydrogenase, fad, flavoprotein, oxidoreductase
Deposited on 2010-04-14, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitroalkane oxidase
    Species: Podospora anserina [TaxId:5145]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2AM55
      • see remark 999 (1)
    Domains in SCOPe 2.07: d3mkha1, d3mkha2
  • Chain 'B':
    Compound: nitroalkane oxidase
    Species: Podospora anserina [TaxId:5145]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2AM55
      • see remark 999 (1)
    Domains in SCOPe 2.07: d3mkhb1, d3mkhb2
  • Chain 'C':
    Compound: nitroalkane oxidase
    Species: Podospora anserina [TaxId:5145]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2AM55
      • see remark 999 (1)
    Domains in SCOPe 2.07: d3mkhc1, d3mkhc2
  • Chain 'D':
    Compound: nitroalkane oxidase
    Species: Podospora anserina [TaxId:5145]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2AM55
      • see remark 999 (1)
    Domains in SCOPe 2.07: d3mkhd1, d3mkhd2
  • Heterogens: FAD, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mkhA (A:)
    maidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagil
    kgqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflap
    flsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfk
    gcdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsg
    phvrytnvrvptknvlcpagqgakvafgafdgsavlvgamgvglmraafdaalkfakedn
    rggavpllerqafadllsgvkiqteaaraltwkaahamengpgdydarrelalaakvfcs
    eaavkactdvinavgisaydlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptyd
    awsstygsfpgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkhA (A:)
    aidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagilk
    gqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflapf
    lsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfkg
    cdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsgp
    hvrytnvrvptknvlcpagqgakvafgafdgsavlvgamgvglmraafdaalkfakednr
    ggavpllerqafadllsgvkiqteaaraltwkaahamengpgdydarrelalaakvfcse
    aavkactdvinavgisaydlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptyda
    wsstyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mkhB (B:)
    maidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagil
    kgqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflap
    flsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfk
    gcdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsg
    phvrytnvrvptknvlcpagqgakvafgafdgsavlvgamgvglmraafdaalkfakedn
    rggavpllerqafadllsgvkiqteaaraltwkaahamengpgdydarrelalaakvfcs
    eaavkactdvinavgisaydlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptyd
    awsstygsfpgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkhB (B:)
    aidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagilk
    gqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflapf
    lsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfkg
    cdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsgp
    hvrytnvrvptknvlcpagqgakvafgafdgsavlvgamgvglmraafdaalkfakednr
    ggavpllerqafadllsgvkiqteaaraltwkaahamengpgdydarrelalaakvfcse
    aavkactdvinavgisaydlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptyda
    wsstyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mkhC (C:)
    maidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagil
    kgqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflap
    flsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfk
    gcdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsg
    phvrytnvrvptknvlcpagqgakvafgafdgsavlvgamgvglmraafdaalkfakedn
    rggavpllerqafadllsgvkiqteaaraltwkaahamengpgdydarrelalaakvfcs
    eaavkactdvinavgisaydlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptyd
    awsstygsfpgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkhC (C:)
    aidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagilk
    gqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflapf
    lsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfkg
    cdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsgp
    hvrytnvrvptknvlcpagqgakvafgafdgsavlvgamgvglmraafdaalkfakednr
    ggavpllerqafadllsgvkiqteaaraltwkaahamengpgdydarrelalaakvfcse
    aavkactdvinavgisaydlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptyda
    wsstyg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mkhD (D:)
    maidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagil
    kgqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflap
    flsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfk
    gcdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsg
    phvrytnvrvptknvlcpagqgakvafgafdgsavlvgamgvglmraafdaalkfakedn
    rggavpllerqafadllsgvkiqteaaraltwkaahamengpgdydarrelalaakvfcs
    eaavkactdvinavgisaydlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptyd
    awsstygsfpgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkhD (D:)
    aidfhlsasqkgtyqaarslarnllmparqtylqhppnsplrfqstqptyaaavsagilk
    gqispahggtggtliesailveecysvepsaaltifatglgltpinlaagpqhaeflapf
    lsgegsplaslvfsepggvanalekgapgfqttarlegdewvingekmwatncagwdfkg
    cdlacvvcrdattpleegqdpenkvmiilvtradldrngegsfevlrhvatpghtsvsgp
    hvrytnvrvptknvlcpagqgakvafgafdgsavlvgamgvglmraafdaalkfakednr
    ggavpllerqafadllsgvkiqteaaraltwkaahamengpgdydarrelalaakvfcse
    aavkactdvinavgisaydlqrpfsdllntavvlpifdggnvgirrrhlqqlmlkptyda
    wsstyg