PDB entry 3mkg

View 3mkg on RCSB PDB site
Description: Low pH as-isolated tomato chloroplast superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase, tomato cu, zn superoxide dismutase, antioxidant, metal-binding, chloroplast, disulfide bond, transit peptide
Deposited on 2010-04-14, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn], chloroplastic
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: SODCP.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkga_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn], chloroplastic
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: SODCP.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkgb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mkgA (A:)
    atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
    gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh
    eleddlgkgghelslttgnaggrlacgvvgltpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkgA (A:)
    tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
    ahfnagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvheleddaggrlacgvvg
    ltpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mkgB (B:)
    atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
    gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh
    eleddlgkgghelslttgnaggrlacgvvgltpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkgB (B:)
    tkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmstg
    ahfnpagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvheledgrlacgvvglt
    pi