PDB entry 3mkd

View 3mkd on RCSB PDB site
Description: Crystal structure of myosin-2 dictyostelium discoideum motor domain S456Y mutant in complex with adp-orthovanadate
Deposited on 2010-04-14, released 2011-04-06
The last revision was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin-2 heavy chain
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (0-691)
      • engineered mutation (454)
  • Heterogens: MG, VO4, ADP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mkdA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfgk
    fieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagp
    esfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfek
    gagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdal
    vkalygrlflwlvkkinnvlcqerkayfigvldiygfeifkvnsfeqlcinytneklqqf
    fnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdn
    tlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfk
    dssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnk
    qlpakledkvvldqlrcngvlegiritrkgfp