PDB entry 3mka

View 3mka on RCSB PDB site
Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome with propetide and an T1A mutation at beta-subunit
Class: hydrolase
Keywords: Mycobacterium tuberculosis, Proteasome Endopeptidase Complex, Protein Subunits, Propeptide, Protein maturation, Proteasome Assembly, HYDROLASE
Deposited on 2010-04-14, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mka1_
  • Chain '2':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mka2_
  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkaa_
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkab_
  • Chain 'C':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkac_
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkad_
  • Chain 'E':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkae_
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkaf_
  • Chain 'G':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkag_
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkah_
  • Chain 'I':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkai_
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkaj_
  • Chain 'K':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkak_
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkal_
  • Chain 'M':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkam_
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkan_
  • Chain 'O':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkao_
  • Chain 'P':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkap_
  • Chain 'Q':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkaq_
  • Chain 'R':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkar_
  • Chain 'S':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkas_
  • Chain 'T':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkat_
  • Chain 'U':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkau_
  • Chain 'V':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkav_
  • Chain 'W':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkaw_
  • Chain 'X':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkax_
  • Chain 'Y':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mkay_
  • Chain 'Z':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245
      • engineered (57)
    Domains in SCOPe 2.07: d3mkaz_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3mka1 (1:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mka1 (1:)
    yfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaa
    agkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcv
    aevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalria
    vaalralgvaslevavldanrprrafrritgsalqallv
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3mka2 (2:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mka2 (2:)
    vdlssftdflrrqapellpqlphgativalkypggvvmagdrrstqgnmisgrdvrkvyi
    tddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnlaaamq
    gllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkklysq
    vtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriaelara
    iiesrs
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mkaA (A:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaA (A:)
    pyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfa
    aagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelc
    vaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalri
    avaalragslgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mkaB (B:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaB (B:)
    yfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaa
    agkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcv
    aevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalria
    vaalragsgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mkaC (C:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaC (C:)
    avdlssftdflrrqapellpasiqlphgativalkypggvvmagdrrstqgnmisgrdvr
    kvyitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnla
    aamqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkk
    lysqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriae
    laraiiesrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mkaD (D:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaD (D:)
    fpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgf
    aaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevel
    cvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalr
    iavaalragslgvaslevavldanrprrafrritgsalqall
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mkaE (E:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaE (E:)
    avdlssftdflrrqapellpalphgativalkypggvvmagdrrstqgnmisgrdvrkvy
    itddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnlaaam
    qgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkklys
    qvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriaelar
    aiiesrsg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mkaF (F:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaF (F:)
    yfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaa
    agkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcv
    aevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalria
    vaalragslgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mkaG (G:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaG (G:)
    avdlssftdflrrqapellpasiaqlphgativalkypggvvmagdrrstqgnmisgrdv
    rkvyitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnl
    aaamqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmk
    klysqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesria
    elaraiiesrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mkaH (H:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaH (H:)
    avdlssftdflrrqapellpaaqlphgativalkypggvvmagdrrstqgnmisgrdvrk
    vyitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnlaa
    amqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkkl
    ysqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriael
    araiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3mkaI (I:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaI (I:)
    yfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaa
    agkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcv
    aevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalria
    vaalragsaslevavldanrprrafrritgsalqall
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3mkaJ (J:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaJ (J:)
    avdlssftdflrrqapellpasisgqlphgativalkypggvvmagdrrstqgnmisgrd
    vrkvyitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgn
    laaamqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssm
    kklysqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesri
    aelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3mkaK (K:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaK (K:)
    pyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfa
    aagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelc
    vaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalri
    avaalragsgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mkaL (L:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaL (L:)
    vdlssftdflrrqapellpasiqlphgativalkypggvvmagdrrstqgnmisgrdvrk
    vyitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnlaa
    amqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkkl
    ysqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriael
    araiiesrsga
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3mkaM (M:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaM (M:)
    sfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvg
    faaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyeve
    lcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdal
    riavaalragslgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3mkaN (N:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaN (N:)
    avdlssftdflrrqapellpasisqlphgativalkypggvvmagdrrstqgnmisgrdv
    rkvyitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnl
    aaamqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmk
    klysqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesria
    elaraiiesrsg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3mkaO (O:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaO (O:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alragsgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3mkaP (P:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaP (P:)
    avdlssftdflrrqapellpasiqlphgativalkypggvvmagdrrstqgnmisgrdvr
    kvyitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnla
    aamqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkk
    lysqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriae
    laraiiesrs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3mkaQ (Q:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaQ (Q:)
    fpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgf
    aaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevel
    cvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalr
    iavaalragsgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3mkaR (R:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaR (R:)
    avdlssftdflrrqapellpaphgativalkypggvvmagdrrstqgnmisgrdvrkvyi
    tddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnlaaamq
    gllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkklysq
    vtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriaelara
    iiesrs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3mkaS (S:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaS (S:)
    fispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaa
    gkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcva
    evahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriav
    aalragsgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3mkaT (T:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaT (T:)
    vdlssftdflrrqapellpasisqlphgativalkypggvvmagdrrstqgnmisgrdvr
    kvyitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnla
    aamqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkk
    lysqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriae
    laraiiesrs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3mkaU (U:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaU (U:)
    yfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaa
    agkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcv
    aevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalria
    vaalragslgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3mkaV (V:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaV (V:)
    avdlssftdflrrqapellpaqlphgativalkypggvvmagdrrstqgnmisgrdvrkv
    yitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnlaaa
    mqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkkly
    sqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriaela
    raiiesrsg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3mkaW (W:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaW (W:)
    fpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgf
    aaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevel
    cvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalr
    iavaalraggvaslevavldanrprrafrritgsalqallv
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3mkaX (X:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaX (X:)
    vdlssftdflrrqapellpasiqlphgativalkypggvvmagdrrstqgnmisgrdvrk
    vyitddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnlaa
    amqgllalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkkl
    ysqvtdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriael
    araiiesrs
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3mkaY (Y:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaY (Y:)
    sfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvg
    faaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyeve
    lcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdal
    riavaalragslgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3mkaZ (Z:)
    mtwplpdrlsinslsgtpavdlssftdflrrqapellpasisggaplaggdaqlphgati
    valkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlyavel
    ehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagrivsf
    daaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatgg
    pdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mkaZ (Z:)
    vdlssftdflrrqapellpaphgativalkypggvvmagdrrstqgnmisgrdvrkvyit
    ddytatgiagtaavavefarlyavelehyeklegvpltfagkinrlaimvrgnlaaamqg
    llalpllagydihasdpqsagrivsfdaaggwnieeegyqavgsgslfakssmkklysqv
    tdgdsglrvavealydaadddsatggpdlvrgifptaviidadgavdvpesriaelarai
    iesrs