PDB entry 3mk9

View 3mk9 on RCSB PDB site
Description: Stabilized Ricin Immunogen 1-33/44-198
Deposited on 2010-04-14, released 2010-11-10
The last revision was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.211
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02879
      • engineered (39)
      • engineered (89)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mk9A (A:)
    mifpkqypiinfttagatvqsytnfiravrgrltvlpnrcglpinqrfilvelsnhaels
    vtlaldvtnayvvgyragnsayffhpdnqcdaeaithlftdvqnrytfafggnydrleql
    agnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyiegemr
    trirynrrs
    

    Sequence, based on observed residues (ATOM records):
    >3mk9A (A:)
    ypiinfttagatvqsytnfiravrgrltvlpnrcglpinqrfilvelsnhaelsvtlald
    vtnayvvgyragnsayffhpdnqcdaeaithlftdvqnrytfafggnydrleqlagnlre
    nielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyiegem