PDB entry 3mk7

View 3mk7 on RCSB PDB site
Description: The structure of CBB3 cytochrome oxidase
Deposited on 2010-04-14, released 2010-08-04
The last revision was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.191
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase, cbb3-type, subunit N
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7
  • Chain 'B':
    Compound: Cytochrome c oxidase, cbb3-type, subunit O
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7
  • Chain 'C':
    Compound: Cytochrome c oxidase, cbb3-type, subunit P
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7 (0-End)
  • Chain 'D':
    Compound: Cytochrome c oxidase, cbb3-type, subunit N
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7
  • Chain 'E':
    Compound: Cytochrome c oxidase, cbb3-type, subunit O
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7
  • Chain 'F':
    Compound: Cytochrome c oxidase, cbb3-type, subunit P
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7 (0-End)
  • Chain 'G':
    Compound: Cytochrome c oxidase, cbb3-type, subunit N
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7
  • Chain 'H':
    Compound: Cytochrome c oxidase, cbb3-type, subunit O
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7
  • Chain 'I':
    Compound: Cytochrome c oxidase, cbb3-type, subunit P
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7 (0-End)
  • Chain 'K':
    Compound: Cytochrome c oxidase, cbb3-type, subunit N
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7
  • Chain 'L':
    Compound: Cytochrome c oxidase, cbb3-type, subunit O
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7
  • Chain 'M':
    Compound: Cytochrome c oxidase, cbb3-type, subunit P
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7 (0-End)
  • Chain 'U':
    Compound: 30-mer peptide
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7 (0-29)
  • Chain 'X':
    Compound: 30-mer peptide
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7 (0-29)
  • Chain 'Y':
    Compound: 30-mer peptide
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7 (0-29)
  • Chain 'Z':
    Compound: 30-mer peptide
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MK7 (0-29)
  • Heterogens: HEM, CU, CA, PEO, PO4, HEC, FC6

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mk7A (A:)
    mntatstaysykvvrqfaimtvvwgivgmglgvfiaaqlawpflnfdlpwtsfgrlrplh
    tnavifafggcalfatsyysvqrtcqttlfapklaaftfwgwqlvillaaislplgftss
    keyaelewpidilitivwvayavvffgtlakrkvkhiyvgnwffgafiltvailhvvnnl
    eipvtamksyslyagatdamvqwwyghnavgffltagflgimyyfvpkqaerpvysyrls
    ivhfwalitvyiwagphhlhytalpdwaqslgmvmslillapswggmingmmtlsgawhk
    lrsdpilrflvvslafygmstfegpmmaiktvnalshytdwtighvhagalgwvamvsig
    alyhlvpkvfgreqmhsiglinthfwlatigtvlyiasmwvngiaqglmwrainddgtlt
    ysfvesleashpgfvvrmiggaiffagmlvmayntwrtvqaakpaeydaaaqia
    

    Sequence, based on observed residues (ATOM records):
    >3mk7A (A:)
    tstaysykvvrqfaimtvvwgivgmglgvfiaaqlawpflnfdlpwtsfgrlrplhtnav
    ifafggcalfatsyysvqrtcqttlfapklaaftfwgwqlvillaaislplgftsskeya
    elewpidilitivwvayavvffgtlakrkvkhiyvgnwffgafiltvailhvvnnleipv
    tamksyslyagatdamvqwwyghnavgffltagflgimyyfvpkqaerpvysyrlsivhf
    walitvyiwagphhlhytalpdwaqslgmvmslillapswggmingmmtlsgawhklrsd
    pilrflvvslafygmstfegpmmaiktvnalshytdwtighvhagalgwvamvsigalyh
    lvpkvfgreqmhsiglinthfwlatigtvlyiasmwvngiaqglmwrainddgtltysfv
    esleashpgfvvrmiggaiffagmlvmayntwrtvqaakpaeydaa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mk7B (B:)
    mkshekleknvglltlfmilavsiggltqivplffqdsvnepvegmkpytalqlegrdly
    iregcvgchsqmirpfraeteryghysvagesvydhpflwgskrtgpdlarvggrysddw
    hrahlynprnvvpeskmpsypwlventldgkdtakkmsalrmlgvpyteediagardsvn
    gktemdamvaylqvlgtaltnkr
    

    Sequence, based on observed residues (ATOM records):
    >3mk7B (B:)
    kleknvglltlfmilavsiggltqivplffqdsvnepvegmkpytalqlegrdlyiregc
    vgchsqmirpfraeteryghysvagesvydhpflwgskrtgpdlarvggrysddwhrahl
    ynprnvvpeskmpsypwlventldgkdtakkmsalrmlgvpyteediagardsvngktem
    damvaylqvlgtaltnk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mk7C (C:)
    mstfwsgyialltlgtivalfwlifatrkgesagttdqtmghafdgieeydnplprwwfl
    lfigtlvfgilylvlypglgnwkgvlpgyeggwtqekqwerevaqadekygpifakyaam
    sveevaqdpqavkmgarlfanycsichgsdakgslgfpnladqdwrwggdaasiktsiln
    griaampawgqaigeegvknvaafvrkdlaglplpegtdadlsagknvyaqtcavchgqg
    gegmaalgapklnsaagwiygsslgqlqqtirhgrngqmpaqqqylgddkvhllaayvys
    lsqkpeqlanq
    

    Sequence, based on observed residues (ATOM records):
    >3mk7C (C:)
    mstfwsgyialltlgtivalfwlifatrkgesagttdqtmghafdgieeydnplprwwfl
    lfigtlvfgilylvlypglgnwkgvlpgyeggwtqekqwerevaqadekygpifakyaam
    sveevaqdpqavkmgarlfanycsichgsdakgslgfpnladqdwrwggdaasiktsiln
    griaampawgqaigeegvknvaafvrkdlaglplpegtdadlsagknvyaqtcavchgqg
    gegmaalgapklnsaagwiygsslgqlqqtirhgrngqmpaqqqylgddkvhllaayvys
    lsq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mk7D (D:)
    mntatstaysykvvrqfaimtvvwgivgmglgvfiaaqlawpflnfdlpwtsfgrlrplh
    tnavifafggcalfatsyysvqrtcqttlfapklaaftfwgwqlvillaaislplgftss
    keyaelewpidilitivwvayavvffgtlakrkvkhiyvgnwffgafiltvailhvvnnl
    eipvtamksyslyagatdamvqwwyghnavgffltagflgimyyfvpkqaerpvysyrls
    ivhfwalitvyiwagphhlhytalpdwaqslgmvmslillapswggmingmmtlsgawhk
    lrsdpilrflvvslafygmstfegpmmaiktvnalshytdwtighvhagalgwvamvsig
    alyhlvpkvfgreqmhsiglinthfwlatigtvlyiasmwvngiaqglmwrainddgtlt
    ysfvesleashpgfvvrmiggaiffagmlvmayntwrtvqaakpaeydaaaqia
    

    Sequence, based on observed residues (ATOM records):
    >3mk7D (D:)
    aysykvvrqfaimtvvwgivgmglgvfiaaqlawpflnfdlpwtsfgrlrplhtnavifa
    fggcalfatsyysvqrtcqttlfapklaaftfwgwqlvillaaislplgftsskeyaele
    wpidilitivwvayavvffgtlakrkvkhiyvgnwffgafiltvailhvvnnleipvtam
    ksyslyagatdamvqwwyghnavgffltagflgimyyfvpkqaerpvysyrlsivhfwal
    itvyiwagphhlhytalpdwaqslgmvmslillapswggmingmmtlsgawhklrsdpil
    rflvvslafygmstfegpmmaiktvnalshytdwtighvhagalgwvamvsigalyhlvp
    kvfgreqmhsiglinthfwlatigtvlyiasmwvngiaqglmwrainddgtltysfvesl
    eashpgfvvrmiggaiffagmlvmayntwrtvqaakpaeydaa
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mk7E (E:)
    mkshekleknvglltlfmilavsiggltqivplffqdsvnepvegmkpytalqlegrdly
    iregcvgchsqmirpfraeteryghysvagesvydhpflwgskrtgpdlarvggrysddw
    hrahlynprnvvpeskmpsypwlventldgkdtakkmsalrmlgvpyteediagardsvn
    gktemdamvaylqvlgtaltnkr
    

    Sequence, based on observed residues (ATOM records):
    >3mk7E (E:)
    kleknvglltlfmilavsiggltqivplffqdsvnepvegmkpytalqlegrdlyiregc
    vgchsqmirpfraeteryghysvagesvydhpflwgskrtgpdlarvggrysddwhrahl
    ynprnvvpeskmpsypwlventldgkdtakkmsalrmlgvpyteediagardsvngktem
    damvaylqvlgtaltnk
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mk7F (F:)
    mstfwsgyialltlgtivalfwlifatrkgesagttdqtmghafdgieeydnplprwwfl
    lfigtlvfgilylvlypglgnwkgvlpgyeggwtqekqwerevaqadekygpifakyaam
    sveevaqdpqavkmgarlfanycsichgsdakgslgfpnladqdwrwggdaasiktsiln
    griaampawgqaigeegvknvaafvrkdlaglplpegtdadlsagknvyaqtcavchgqg
    gegmaalgapklnsaagwiygsslgqlqqtirhgrngqmpaqqqylgddkvhllaayvys
    lsqkpeqlanq
    

    Sequence, based on observed residues (ATOM records):
    >3mk7F (F:)
    mstfwsgyialltlgtivalfwlifatrkgesagttdqtmghafdgieeydnplprwwfl
    lfigtlvfgilylvlypglgnwkgvlpgyeggwtqekqwerevaqadekygpifakyaam
    sveevaqdpqavkmgarlfanycsichgsdakgslgfpnladqdwrwggdaasiktsiln
    griaampawgqaigeegvknvaafvrkdlaglplpegtdadlsagknvyaqtcavchgqg
    gegmaalgapklnsaagwiygsslgqlqqtirhgrngqmpaqqqylgddkvhllaayvys
    lsq
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mk7G (G:)
    mntatstaysykvvrqfaimtvvwgivgmglgvfiaaqlawpflnfdlpwtsfgrlrplh
    tnavifafggcalfatsyysvqrtcqttlfapklaaftfwgwqlvillaaislplgftss
    keyaelewpidilitivwvayavvffgtlakrkvkhiyvgnwffgafiltvailhvvnnl
    eipvtamksyslyagatdamvqwwyghnavgffltagflgimyyfvpkqaerpvysyrls
    ivhfwalitvyiwagphhlhytalpdwaqslgmvmslillapswggmingmmtlsgawhk
    lrsdpilrflvvslafygmstfegpmmaiktvnalshytdwtighvhagalgwvamvsig
    alyhlvpkvfgreqmhsiglinthfwlatigtvlyiasmwvngiaqglmwrainddgtlt
    ysfvesleashpgfvvrmiggaiffagmlvmayntwrtvqaakpaeydaaaqia
    

    Sequence, based on observed residues (ATOM records):
    >3mk7G (G:)
    staysykvvrqfaimtvvwgivgmglgvfiaaqlawpflnfdlpwtsfgrlrplhtnavi
    fafggcalfatsyysvqrtcqttlfapklaaftfwgwqlvillaaislplgftsskeyae
    lewpidilitivwvayavvffgtlakrkvkhiyvgnwffgafiltvailhvvnnleipvt
    amksyslyagatdamvqwwyghnavgffltagflgimyyfvpkqaerpvysyrlsivhfw
    alitvyiwagphhlhytalpdwaqslgmvmslillapswggmingmmtlsgawhklrsdp
    ilrflvvslafygmstfegpmmaiktvnalshytdwtighvhagalgwvamvsigalyhl
    vpkvfgreqmhsiglinthfwlatigtvlyiasmwvngiaqglmwrainddgtltysfve
    sleashpgfvvrmiggaiffagmlvmayntwrtvqaakpaeydaa
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mk7H (H:)
    mkshekleknvglltlfmilavsiggltqivplffqdsvnepvegmkpytalqlegrdly
    iregcvgchsqmirpfraeteryghysvagesvydhpflwgskrtgpdlarvggrysddw
    hrahlynprnvvpeskmpsypwlventldgkdtakkmsalrmlgvpyteediagardsvn
    gktemdamvaylqvlgtaltnkr
    

    Sequence, based on observed residues (ATOM records):
    >3mk7H (H:)
    kleknvglltlfmilavsiggltqivplffqdsvnepvegmkpytalqlegrdlyiregc
    vgchsqmirpfraeteryghysvagesvydhpflwgskrtgpdlarvggrysddwhrahl
    ynprnvvpeskmpsypwlventldgkdtakkmsalrmlgvpyteediagardsvngktem
    damvaylqvlgtaltnk
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3mk7I (I:)
    mstfwsgyialltlgtivalfwlifatrkgesagttdqtmghafdgieeydnplprwwfl
    lfigtlvfgilylvlypglgnwkgvlpgyeggwtqekqwerevaqadekygpifakyaam
    sveevaqdpqavkmgarlfanycsichgsdakgslgfpnladqdwrwggdaasiktsiln
    griaampawgqaigeegvknvaafvrkdlaglplpegtdadlsagknvyaqtcavchgqg
    gegmaalgapklnsaagwiygsslgqlqqtirhgrngqmpaqqqylgddkvhllaayvys
    lsqkpeqlanq
    

    Sequence, based on observed residues (ATOM records):
    >3mk7I (I:)
    mstfwsgyialltlgtivalfwlifatrkgesagttdqtmghafdgieeydnplprwwfl
    lfigtlvfgilylvlypglgnwkgvlpgyeggwtqekqwerevaqadekygpifakyaam
    sveevaqdpqavkmgarlfanycsichgsdakgslgfpnladqdwrwggdaasiktsiln
    griaampawgqaigeegvknvaafvrkdlaglplpegtdadlsagknvyaqtcavchgqg
    gegmaalgapklnsaagwiygsslgqlqqtirhgrngqmpaqqqylgddkvhllaayvys
    lsq
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3mk7K (K:)
    mntatstaysykvvrqfaimtvvwgivgmglgvfiaaqlawpflnfdlpwtsfgrlrplh
    tnavifafggcalfatsyysvqrtcqttlfapklaaftfwgwqlvillaaislplgftss
    keyaelewpidilitivwvayavvffgtlakrkvkhiyvgnwffgafiltvailhvvnnl
    eipvtamksyslyagatdamvqwwyghnavgffltagflgimyyfvpkqaerpvysyrls
    ivhfwalitvyiwagphhlhytalpdwaqslgmvmslillapswggmingmmtlsgawhk
    lrsdpilrflvvslafygmstfegpmmaiktvnalshytdwtighvhagalgwvamvsig
    alyhlvpkvfgreqmhsiglinthfwlatigtvlyiasmwvngiaqglmwrainddgtlt
    ysfvesleashpgfvvrmiggaiffagmlvmayntwrtvqaakpaeydaaaqia
    

    Sequence, based on observed residues (ATOM records):
    >3mk7K (K:)
    staysykvvrqfaimtvvwgivgmglgvfiaaqlawpflnfdlpwtsfgrlrplhtnavi
    fafggcalfatsyysvqrtcqttlfapklaaftfwgwqlvillaaislplgftsskeyae
    lewpidilitivwvayavvffgtlakrkvkhiyvgnwffgafiltvailhvvnnleipvt
    amksyslyagatdamvqwwyghnavgffltagflgimyyfvpkqaerpvysyrlsivhfw
    alitvyiwagphhlhytalpdwaqslgmvmslillapswggmingmmtlsgawhklrsdp
    ilrflvvslafygmstfegpmmaiktvnalshytdwtighvhagalgwvamvsigalyhl
    vpkvfgreqmhsiglinthfwlatigtvlyiasmwvngiaqglmwrainddgtltysfve
    sleashpgfvvrmiggaiffagmlvmayntwrtvqaakpaeydaa
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3mk7L (L:)
    mkshekleknvglltlfmilavsiggltqivplffqdsvnepvegmkpytalqlegrdly
    iregcvgchsqmirpfraeteryghysvagesvydhpflwgskrtgpdlarvggrysddw
    hrahlynprnvvpeskmpsypwlventldgkdtakkmsalrmlgvpyteediagardsvn
    gktemdamvaylqvlgtaltnkr
    

    Sequence, based on observed residues (ATOM records):
    >3mk7L (L:)
    kleknvglltlfmilavsiggltqivplffqdsvnepvegmkpytalqlegrdlyiregc
    vgchsqmirpfraeteryghysvagesvydhpflwgskrtgpdlarvggrysddwhrahl
    ynprnvvpeskmpsypwlventldgkdtakkmsalrmlgvpyteediagardsvngktem
    damvaylqvlgtaltnk
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3mk7M (M:)
    mstfwsgyialltlgtivalfwlifatrkgesagttdqtmghafdgieeydnplprwwfl
    lfigtlvfgilylvlypglgnwkgvlpgyeggwtqekqwerevaqadekygpifakyaam
    sveevaqdpqavkmgarlfanycsichgsdakgslgfpnladqdwrwggdaasiktsiln
    griaampawgqaigeegvknvaafvrkdlaglplpegtdadlsagknvyaqtcavchgqg
    gegmaalgapklnsaagwiygsslgqlqqtirhgrngqmpaqqqylgddkvhllaayvys
    lsqkpeqlanq
    

    Sequence, based on observed residues (ATOM records):
    >3mk7M (M:)
    mstfwsgyialltlgtivalfwlifatrkgesagttdqtmghafdgieeydnplprwwfl
    lfigtlvfgilylvlypglgnwkgvlpgyeggwtqekqwerevaqadekygpifakyaam
    sveevaqdpqavkmgarlfanycsichgsdakgslgfpnladqdwrwggdaasiktsiln
    griaampawgqaigeegvknvaafvrkdlaglplpegtdadlsagknvyaqtcavchgqg
    gegmaalgapklnsaagwiygsslgqlqqtirhgrngqmpaqqqylgddkvhllaayvys
    lsq
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >3mk7U (U:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >3mk7X (X:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records:
    >3mk7Y (Y:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >3mk7Z (Z:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx