PDB entry 3mk6

View 3mk6 on RCSB PDB site
Description: Substrate and Inhibitor Binding to Pank
Class: transferase
Keywords: PANK, Inhibitor, TRANSFERASE
Deposited on 2010-04-14, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H999 (19-375)
      • expression tag (13-18)
    Domains in SCOPe 2.07: d3mk6a1, d3mk6a2, d3mk6a3
  • Chain 'B':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H999 (19-375)
      • expression tag (14-18)
    Domains in SCOPe 2.07: d3mk6b1, d3mk6b2, d3mk6b3
  • Chain 'C':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H999 (19-End)
      • expression tag (13-18)
    Domains in SCOPe 2.07: d3mk6c1, d3mk6c2, d3mk6c3
  • Chain 'D':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H999 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d3mk6d1, d3mk6d2, d3mk6d3
  • Heterogens: ACO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mk6A (A:)
    mgsshhhhhhssglvprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyl
    tsnvaygstgirdvhlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlc
    atgggaykfekdfrtignlhlhkldeldclvkgllyidsvsfngqaecyyfanaseperc
    qkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfe
    ealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmiykekresvskedlara
    tlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalfle
    hegyfgavgallglpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mk6A (A:)
    lvprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnirdvhlelkd
    ltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfignlhlh
    kldeldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypllvvnigsgv
    silavhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiy
    ggdyerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavneki
    nrvvfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallglpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mk6B (B:)
    mgsshhhhhhssglvprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyl
    tsnvaygstgirdvhlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlc
    atgggaykfekdfrtignlhlhkldeldclvkgllyidsvsfngqaecyyfanaseperc
    qkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfe
    ealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmiykekresvskedlara
    tlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalfle
    hegyfgavgallglpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mk6B (B:)
    vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsntgirdvhlelk
    dltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekignlhlhk
    ldeldclvkgllyidsvsfqaecyyfanasepercqkmpfnlddpypllvvnigsgvsil
    avhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiyggd
    yerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavnekinrv
    vfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallglpn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mk6C (C:)
    mgsshhhhhhssglvprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyl
    tsnvaygstgirdvhlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlc
    atgggaykfekdfrtignlhlhkldeldclvkgllyidsvsfngqaecyyfanaseperc
    qkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfe
    ealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmiykekresvskedlara
    tlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalfle
    hegyfgavgallglpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mk6C (C:)
    lvprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnrdvhlelkdl
    tlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfgnlhlhkl
    deldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypllvvnigsgvsi
    lavhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiygg
    dyerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavnekinr
    vvfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallglp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mk6D (D:)
    mgsshhhhhhssglvprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyl
    tsnvaygstgirdvhlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlc
    atgggaykfekdfrtignlhlhkldeldclvkgllyidsvsfngqaecyyfanaseperc
    qkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfe
    ealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmiykekresvskedlara
    tlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalfle
    hegyfgavgallglpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mk6D (D:)
    spwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsngirdvhlelkdltlf
    grrgnlhfirfptqdlptfiqmgrdknfstlcatgggaykfekdfrtignlhlhkldeld
    clvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypllvvnigsgvsilavh
    skdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiyggdyer
    fglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavnekinrvvfv
    gnflrvntlsmkllayaldywskgqlkalflehegyfgavgallg