PDB entry 3mk5

View 3mk5 on RCSB PDB site
Description: Crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase domain from Mycobacterium tuberculosis with sulfate and zinc at pH 4.00
Class: lyase
Keywords: Riboflavin, FMN, FAD, DHBPS, Sulfate, LYASE
Deposited on 2010-04-14, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: ribA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U2B7 (6-211)
      • expression tag (5)
    Domains in SCOPe 2.07: d3mk5a1, d3mk5a2
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mk5A (A:)
    vprgshmtrldsveravadiaagkavividdedrenegdlifaaekatpemvafmvryts
    gylcvpldgaicdrlgllpmyavnqdkhgtaytvtvdarngigtgisasdrattmrllad
    ptsvaddftrpghvvplrakdggvlrrpghteaavdlarmaglqpagaiceivsqkdegs
    mahtdelrvfadehglalitiadliewrrkhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mk5A (A:)
    hmtrldsveravadiaagkavividdedegdlifaaekatpemvafmvrytsgylcvpld
    gaicdrlgllpmytvtvdarngigtgisasdrattmrlladptsvaddftrpghvvplra
    kdggvlrrpghteaavdlarmaglqpagaiceivsdegsmahtdelrvfadehglaliti
    adliewrrkhe