PDB entry 3mk3

View 3mk3 on RCSB PDB site
Description: Crystal structure of Lumazine synthase from Salmonella typhimurium LT2
Deposited on 2010-04-14, released 2011-02-02
The last revision was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 3.57 Å
R-factor: 0.226
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '8':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '9':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'w':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'y':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence, based on SEQRES records:
    >3mk31 (1:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk31 (1:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >3mk32 (2:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk32 (2:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >3mk33 (3:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk33 (3:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '4':
    Sequence, based on SEQRES records:
    >3mk34 (4:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk34 (4:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '5':
    Sequence, based on SEQRES records:
    >3mk35 (5:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk35 (5:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '6':
    Sequence, based on SEQRES records:
    >3mk36 (6:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk36 (6:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '7':
    Sequence, based on SEQRES records:
    >3mk37 (7:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk37 (7:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '8':
    Sequence, based on SEQRES records:
    >3mk38 (8:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk38 (8:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '9':
    Sequence, based on SEQRES records:
    >3mk39 (9:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk39 (9:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mk3A (A:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3A (A:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mk3B (B:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3B (B:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mk3C (C:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3C (C:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mk3D (D:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3D (D:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mk3E (E:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3E (E:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mk3F (F:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3F (F:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mk3G (G:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3G (G:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mk3H (H:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3H (H:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3mk3I (I:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3I (I:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3mk3J (J:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3J (J:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3mk3K (K:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3K (K:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3mk3L (L:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3L (L:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3mk3M (M:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3M (M:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >3mk3N (N:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3N (N:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >3mk3O (O:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3O (O:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3mk3P (P:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3P (P:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >3mk3Q (Q:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3Q (Q:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >3mk3R (R:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3R (R:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >3mk3S (S:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3S (S:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >3mk3T (T:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3T (T:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >3mk3U (U:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3U (U:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >3mk3V (V:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3V (V:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >3mk3W (W:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3W (W:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3mk3X (X:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3X (X:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >3mk3Y (Y:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3Y (Y:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >3mk3Z (Z:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3Z (Z:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >3mk3a (a:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3a (a:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >3mk3b (b:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3b (b:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >3mk3c (c:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3c (c:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >3mk3d (d:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3d (d:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >3mk3e (e:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3e (e:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >3mk3f (f:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3f (f:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >3mk3g (g:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3g (g:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >3mk3h (h:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3h (h:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'i':
    Sequence, based on SEQRES records:
    >3mk3i (i:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3i (i:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'j':
    Sequence, based on SEQRES records:
    >3mk3j (j:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3j (j:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'k':
    Sequence, based on SEQRES records:
    >3mk3k (k:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3k (k:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'l':
    Sequence, based on SEQRES records:
    >3mk3l (l:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3l (l:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'm':
    Sequence, based on SEQRES records:
    >3mk3m (m:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3m (m:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'n':
    Sequence, based on SEQRES records:
    >3mk3n (n:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3n (n:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'o':
    Sequence, based on SEQRES records:
    >3mk3o (o:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3o (o:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'p':
    Sequence, based on SEQRES records:
    >3mk3p (p:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3p (p:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'q':
    Sequence, based on SEQRES records:
    >3mk3q (q:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3q (q:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'r':
    Sequence, based on SEQRES records:
    >3mk3r (r:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3r (r:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 's':
    Sequence, based on SEQRES records:
    >3mk3s (s:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3s (s:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 't':
    Sequence, based on SEQRES records:
    >3mk3t (t:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3t (t:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'u':
    Sequence, based on SEQRES records:
    >3mk3u (u:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3u (u:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'v':
    Sequence, based on SEQRES records:
    >3mk3v (v:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3v (v:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'w':
    Sequence, based on SEQRES records:
    >3mk3w (w:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3w (w:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'x':
    Sequence, based on SEQRES records:
    >3mk3x (x:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3x (x:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'y':
    Sequence, based on SEQRES records:
    >3mk3y (y:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3mk3y (y:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai