PDB entry 3mk2

View 3mk2 on RCSB PDB site
Description: Placental alkaline phosphatase complexed with Phe
Class: hydrolase
Keywords: Phe binding, HYDROLASE
Deposited on 2010-04-13, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.125
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline phosphatase, placental type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mk2a_
  • Heterogens: PHE, ZN, MG, CA, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mk2A (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa
    gttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mk2A (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa
    g