PDB entry 3mk1

View 3mk1 on RCSB PDB site
Description: Refinement of placental alkaline phosphatase complexed with nitrophenyl
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-04-13, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.141
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline phosphatase, placental type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mk1a_
  • Heterogens: ZN, MG, CA, NPO, PO4, ACT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mk1A (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa
    gttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mk1A (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa
    g