PDB entry 3mjz

View 3mjz on RCSB PDB site
Description: The crystal structure of native FG41 MSAD
Class: isomerase
Keywords: The tautomerase superfamily, Malonate Semialdehyde Decarboxylase, Beta-alpha-beta-motif, ISOMERASE
Deposited on 2010-04-13, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjza_
  • Chain 'B':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzb_
  • Chain 'C':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzc_
  • Chain 'D':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzd_
  • Chain 'E':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjze_
  • Chain 'F':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzf_
  • Chain 'G':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzg_
  • Chain 'H':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzh_
  • Chain 'I':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzi_
  • Chain 'J':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzj_
  • Chain 'K':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzk_
  • Chain 'L':
    Compound: FG41 Malonate Semialdehyde Decarboxylase
    Species: Coryneform bacterium [TaxId:1728]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJZ (0-End)
    Domains in SCOPe 2.07: d3mjzl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mjzA (A:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzA (A:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mjzB (B:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzB (B:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mjzC (C:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzC (C:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mjzD (D:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzD (D:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mjzE (E:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzE (E:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mjzF (F:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzF (F:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelai
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mjzG (G:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzG (G:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mjzH (H:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzH (H:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3mjzI (I:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzI (I:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3mjzJ (J:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzJ (J:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3mjzK (K:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzK (K:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelai
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mjzL (L:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaipatgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjzL (L:)
    pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
    rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
    aqyvtgelaip