PDB entry 3mjx

View 3mjx on RCSB PDB site
Description: Crystal structure of myosin-2 motor domain in complex with ADP-Metavanadate and blebbistatin
Deposited on 2010-04-13, released 2011-04-27
The last revision was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin-2 heavy chain
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AD9, MG, BIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mjxA (A:)
    mhhhhhhhdgtenpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyec
    geivsetsdsftfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvr
    ynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmldd
    rqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnak
    ttrnnnssrfgkfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagat
    aeekkalhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiia
    gilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhl
    nvekssssrdalvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeql
    cinytneklqqffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilall
    deqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknk
    dplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettn
    phfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryylla
    pnvprdaedsqkatdavlkhlnidpeqyrfgitkiffragqlarieeareqrlesneppm
    dfdddipf
    

    Sequence, based on observed residues (ATOM records):
    >3mjxA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvaggvleqqilqanpileafgnakttrnnnssrfgkfieiqfn
    sagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnyln
    qsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegav
    lkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygr
    lflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmfk
    leqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklh
    shfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvv
    tklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakle
    dkvvldqlrcngvlegiritrkgfpnriiy