PDB entry 3mjw

View 3mjw on RCSB PDB site
Description: PI3 Kinase gamma with a benzofuranone inhibitor
Class: transferase
Keywords: 3D-structure,ATP-binding,Complete proteome,Kinase,Nucleotide-binding,Transferase, TRANSFERASE
Deposited on 2010-04-13, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.225
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (1-End)
      • expression tag (0)
      • conflict (316)
    Domains in SCOPe 2.07: d3mjwa1, d3mjwa2, d3mjwa3, d3mjwa4, d3mjwa5
  • Heterogens: WYF

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mjwA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mjwA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmqdfvlrvcgr
    deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkecdrkfrvkirgidipv
    tvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiyckvrl
    lyyvnlllidhrfllrrgeyvlhmwqisfnadkltsatnpdkensmsisilldnraempn
    qlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyq
    llarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkf
    epyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtaml
    hdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydp
    glkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilr
    imesiwetesldlcllpygcistgdkigmieivkdattiakiqqfkdevlnhwlkekspt
    eekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghirvpfvltpd
    flfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqltskediey
    irdaltvgkneedakkyfldqievcrdkgwtvqfnwflh