PDB entry 3mju

View 3mju on RCSB PDB site
Description: crystal structure determination of pigeon (columba livia) haemoglobin at 3.5 angstrom resolution
Deposited on 2010-04-13, released 2010-12-08
The last revision was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.243
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-A
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Columba livia [TaxId:8932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mjuA (A:)
    vlsandksnvkavfakiggqagdlggealerlfitypqtktyfphfdlshgsaqikghgk
    kvaealveaanhiddiagalsklsdlhaqklrvdpvnfkllghcflvvvavhfpslltpe
    vhasldkfvlavgtvltakyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mjuB (B:)
    vhwsaeekqlitsiwgkvnvadcgaealarllivypwtqrffssfgnlssataisgnpnv
    kahgkkvltsfgdavknldnikgtfaqlselhcdklhvdpenfrllgdilviilaahfgk
    dftpecqaawqklvrvvahalarkyh