PDB entry 3mjs

View 3mjs on RCSB PDB site
Description: Structure of A-type Ketoreductases from Modular Polyketide Synthase
Deposited on 2010-04-13, released 2010-08-18
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.2
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AmphB
    Species: Streptomyces nodosus [TaxId:40318]
    Gene: amphB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93NW7 (21-End)
      • expression tag (18-20)
  • Chain 'B':
    Compound: AmphB
    Species: Streptomyces nodosus [TaxId:40318]
    Gene: amphB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93NW7 (21-End)
      • expression tag (18-20)
  • Heterogens: NDP, LMR, MLT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mjsA (A:)
    mgsshhhhhhssglvprgshmdalryhiewnrvaepgtarpagrllavispdhagapwvt
    avldalgpdtvrfeakgtdraawaaqlaqlredegefhavvsllaaaealhtdhgsvplg
    laqtlllaqalgdagltaplwcltrggvaagrgdvlsspvqgalwglgrviglehpdrwg
    glidlpetvdtraaarltglladaggedqlairgsgvlarrlahaapavpgsgkrppvhg
    svlvtggtggiggrvarrlaeqgaahlvltsrrgadapgaaelraeleqlgvrvtiaacd
    aadrealaallaelpedapltavfhsagvahddapvadltlgqldalmrakltaarhlhe
    ltadldldafvlfssgaavwgsggqpgyaaanayldalaehrrslgltassvawgtwgev
    gmatdpevhdrlvrqgvlamepehalgaldqmlenddtaaaitlmdwemfapaftanrps
    allstvpeavsalsde
    

    Sequence, based on observed residues (ATOM records):
    >3mjsA (A:)
    shmdalryhiewnrvaepgtarpagrllavispdhagapwvtavldalgpdtvrfeakgt
    draawaaqlaqlredegefhavvsllaaaealhtdhgsvplglaqtlllaqalgdaglta
    plwcltrggvaagrgdvlsspvqgalwglgrviglehpdrwgglidlpetvdtraaarlt
    glladaggedqlairgsgvlarrlahaapavpgsgkrppvhgsvlvtggtggiggrvarr
    laeqgaahlvltsrrgadapgaaelraeleqlgvrvtiaacdaadrealaallaelpeda
    pltavfhsagvahddapvadltlgqldalmrakltaarhlheltadldldafvlfssgaa
    vwgsggqpgyaaanayldalaehrrslgltassvawgtwgevgmatdpevhdrlvrqgvl
    amepehalgaldqmlenddtaaaitlmdwemfapaftanrpsallstvpeavsals
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mjsB (B:)
    mgsshhhhhhssglvprgshmdalryhiewnrvaepgtarpagrllavispdhagapwvt
    avldalgpdtvrfeakgtdraawaaqlaqlredegefhavvsllaaaealhtdhgsvplg
    laqtlllaqalgdagltaplwcltrggvaagrgdvlsspvqgalwglgrviglehpdrwg
    glidlpetvdtraaarltglladaggedqlairgsgvlarrlahaapavpgsgkrppvhg
    svlvtggtggiggrvarrlaeqgaahlvltsrrgadapgaaelraeleqlgvrvtiaacd
    aadrealaallaelpedapltavfhsagvahddapvadltlgqldalmrakltaarhlhe
    ltadldldafvlfssgaavwgsggqpgyaaanayldalaehrrslgltassvawgtwgev
    gmatdpevhdrlvrqgvlamepehalgaldqmlenddtaaaitlmdwemfapaftanrps
    allstvpeavsalsde
    

    Sequence, based on observed residues (ATOM records):
    >3mjsB (B:)
    shmdalryhiewnrvaepgtarpagrllavispdhagapwvtavldalgpdtvrfeakgt
    draawaaqlaqlredegefhavvsllaaaealhtdhgsvplglaqtlllaqalgdaglta
    plwcltrggvaagrgdvlsspvqgalwglgrviglehpdrwgglidlpetvdtraaarlt
    glladaggedqlairgsgvlarrlahaapavpgsgkrppvhgsvlvtggtggiggrvarr
    laeqgaahlvltsrrgadapgaaelraeleqlgvrvtiaacdaadrealaallaelpeda
    pltavfhsagvahddapvadltlgqldalmrakltaarhlheltadldldafvlfssgaa
    vwgsggqpgyaaanayldalaehrrslgltassvawgtwgevgmatdpevhdrlvrqgvl
    amepehalgaldqmlenddtaaaitlmdwemfapaftanrpsallstvpeavsal