PDB entry 3mjq

View 3mjq on RCSB PDB site
Description: crystal structure of the pas domain of q24qt8_deshy protein from desulfitobacterium hafniense. northeast structural genomics consortium target dhr85c.
Deposited on 2010-04-13, released 2010-04-28
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Desulfitobacterium hafniense [TaxId:138119]
    Gene: DSY3815
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24QT8
      • engineered (34)
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Desulfitobacterium hafniense [TaxId:138119]
    Gene: DSY3815
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24QT8
      • engineered (34)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mjqA (A:)
    mknfletiedmiliinregrllyantavpkklgytheelmsmhiltitsagkmaegekil
    aelfagkkeslplslekkegtsipakariwqgkwhnepclfaiikdlskeerassppfle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mjqA (A:)
    knfletiedmiliinregrllyantavpkklgytheelmsmhiltitsagkmaegekila
    elfagkkeslplslekkegtsipakariwqgkwhnepclfaiikdls
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mjqB (B:)
    mknfletiedmiliinregrllyantavpkklgytheelmsmhiltitsagkmaegekil
    aelfagkkeslplslekkegtsipakariwqgkwhnepclfaiikdlskeerassppfle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mjqB (B:)
    knfletiedmiliinregrllyantavpkklgytheelmsmhiltitsagkmaegekila
    elfagkkeslplslekkegtsipakariwqgkwhnepclfaiikdl